KEGG   Paenisporosarcina antarctica: E2636_03395
Entry
E2636_03395       CDS       T05927                                 

Definition
(GenBank) acetylornithine transaminase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
panc  Paenisporosarcina antarctica
Pathway
panc00220  Arginine biosynthesis
panc00300  Lysine biosynthesis
panc01100  Metabolic pathways
panc01110  Biosynthesis of secondary metabolites
panc01120  Microbial metabolism in diverse environments
panc01210  2-Oxocarboxylic acid metabolism
panc01230  Biosynthesis of amino acids
Module
panc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:panc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    E2636_03395
   00220 Arginine biosynthesis
    E2636_03395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:panc01007]
    E2636_03395
Enzymes [BR:panc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     E2636_03395
    2.6.1.17  succinyldiaminopimelate transaminase
     E2636_03395
Amino acid related enzymes [BR:panc01007]
 Aminotransferase (transaminase)
  Class III
   E2636_03395
SSDB
Motif
Pfam: Aminotran_3 Aph-1 Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-ProteinID: QBP40250
UniProt: A0A4P6ZUU7
LinkDB
Position
complement(689454..690608)
AA seq 384 aa
MSSLFPTYQRFDIHVNEATGTQVIDEKGNTYLDFISGIAVCNLGHRHPEVQKAIEEQLNK
VWHVSNLFHLSIQEEVAKKLTDYSNGDAVFFCNSGAEANEAAIKLVRKHTKKHKIITFTN
SFHGRTFATMTATGQAKIHDGFGPLVNEFVYLPYNDEEALKSEMDDTVAGIMVEVIQGEG
GVVPGTESFLTTIQHLCETYNALFIIDEIQTGIGRTGKPFAYQHFNLSPDIITVAKGLGS
GLPVGAMIGKSDLIESFGPGTHGSTFGGNPIALASAKATLNIIFNESFLTEVVEKSEDFK
HQLNELVKSYSFVTEVRGKGFMIGIECGEYQAVLLEAMRNKGLLALGAGPHVIRLLPPLT
VSKEELSQAIQIIEQTFSEMKITS
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagttcattatttccaacatatcaacgatttgatatacacgtaaatgaagcaacaggc
acacaagttattgacgaaaagggtaacacctatctagatttcatttcaggtattgctgtt
tgtaacttggggcaccgtcatccggaagtgcaaaaagcaatagaagaacagttaaacaag
gtttggcatgtatcaaatttgtttcatctatccattcaagaagaagtagctaaaaaattg
acggattattcaaatggagatgccgtctttttctgtaatagcggtgctgaagctaatgaa
gcagctatcaaattagtacgtaaacacactaaaaaacacaaaattattacctttacaaat
tcttttcacggtcgaacatttgcaacaatgacagcaacaggacaagcaaaaattcatgat
ggttttggaccgttagtaaacgaatttgtctatcttccttataatgacgaagaagcttta
aaaagtgagatggatgacacagttgcaggcattatggttgaagtaattcaaggtgaaggc
ggcgttgttcctggaacagaatcatttttaacaacgattcaacatttatgtgaaacttat
aatgcattatttattattgatgaaatacaaactggcattggacgtacgggtaaaccgttt
gcctatcagcattttaatttatctcctgatattattacagttgcaaaaggtttaggaagc
ggattgccagtaggagcaatgattggaaaatcagatttaatagaatcattcgggccaggc
actcacggttcaacttttggtggaaatccaattgctcttgcatcagcaaaagcaacgtta
aacattatttttaatgagtcattcttaacagaagttgtagaaaaaagtgaagactttaag
caccaattaaatgaactagttaagagttattcatttgtgacagaagttagaggcaaaggc
tttatgattggcattgaatgtggggaatatcaagcggtcttacttgaagcaatgcgtaat
aaaggattgttagcattaggtgctggtcctcacgtaattcgtttactaccacccttaaca
gtttcaaaagaagaactgagtcaagctattcaaatcattgaacagacttttagcgaaatg
aaaattacttcgtaa

DBGET integrated database retrieval system