KEGG   Pseudomonas aeruginosa PA7: PSPA7_0217Help
Entry
PSPA7_0217        CDS       T00569                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
KEGG Orthology (KO) [BR:pap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSPA7_0217 (ahpF)
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSPA7_0217 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 K_oxygenase Glutaredoxin NAD_binding_7 Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABR84593
UniProt: A6UXS8
LinkDB All DBs
Position
229109..230674
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVGLTDKITLKTDGSDAR
KPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLDAEVIEQVKGIEGTFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVEARQIMSVPSIYLNGEVF
GQGRMGVEEILAKIDTGAAARDAEKLTAREAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEVDIMNLQRASKLVPAKNAGE
LHEVQFESGGSLKARSLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKLYSLPNVEVITSALTSEVKGDG
QKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLKGSVELSPRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaggcctacctggaaaaggtcagccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgagctgctgggcctgctg
caagacatcgtcggcctgaccgacaagatcaccctgaagaccgacggcagcgatgcgcgc
aaaccgtcgttctcgctgaaccgcccgggtgcggacatcggcctgcgcttcgccggtatc
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtaggcggccatccc
tccaagctcgacgcggaggtgatcgagcaggtcaagggcatcgagggcaccttcgagttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggcgcgctgttccaggac
gaggtcgaggcgcgccagatcatgtcggtgccgagcatctacctcaacggcgaagtcttc
ggccagggccgcatgggtgtggaagagatcctcgccaagatcgacaccggcgccgccgcc
cgcgacgccgagaagctcaccgcccgcgaagctttcgacgtgctggtggtcggcggcggt
ccggccggcgccgcggcggcgatctacgccgcgcgcaagggcattcgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
caggagaccgaagggccgaagctggcgcgagcgcttgaagagcatgtgcgccactacgag
gtcgacatcatgaacctgcagcgcgccagcaagctggtgccggcgaagaacgccggcgag
ttgcacgaagtgcagttcgagagcggcggcagcctcaaggccaggagcctgatcctcgcc
accggcgcccgctggcgcgaaatgggcgtgcccggcgagcaggagtacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtg
accctgctggagttcgacagcaagttgcgcgccgacgccgtgctgcaacgcaagctctac
agcctgccgaacgtcgaggtgatcaccagcgccctgaccagcgaagtgaagggcgacggc
cagaaggtcaccggcctggtgtacaaggaccgcaactccgaggagttcaagtcgatcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctcaagggcagc
gtcgagctgtcgccgcgcggcgagatcatcgtcgacgcccgtggcgagacctcgctgccc
gggatcttcgccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtg
ggcgagggcgccaaggcttcgctgagcgccttcgaccacctgatccggacctccgccccg
gagtga

DBGET integrated database retrieval system