KEGG   Parabacteroides sp. CT06: CI960_23075Help
Entry
CI960_23075       CDS       T05011                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
parc  Parabacteroides sp. CT06
Brite
KEGG Orthology (KO) [BR:parc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CI960_23075 (ahpF)
Enzymes [BR:parc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CI960_23075 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like GIDA DAO Thioredoxin_3 FAD_oxidored Thi4 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 Lycopene_cycl FAD_binding_3 Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AST56029
UniProt: A0A223HUB2
LinkDB All DBs
Position
5369017..5370570
Genome map
AA seq 517 aa AA seqDB search
MLESTLKEQLKGIFAGLNANYTFDISISPAHESRQELLDLLGDVASCSDKISMRVSDGDG
LEFILLKDGAKTGIKFRGVPNGHEFTSLLLAILNSDGKGKNFPDESICNRVKALNGSIHL
TTYVSLTCTNCPDVVQALNAMTTLNPQIHHEMVDGAINQAEVDALKIQGVPSVFADGKLI
HVGRGEFGELLSKLEAQYGINESLTEKTVKRYDVVVVGGGPAGASAAIYSARKGLSVAVV
AERIGGQVKETVGIENLISVPETTGTQLADNLRLHMRQYPIDLLEHRRIEKVTIEGNEKV
LSTAGGEIFKAPAVIVATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKHVAVVGGG
NSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKAKSLPNVEIFVSSQTTEVVGNGDKV
TGIRTKDRKTGEERVIHLDGIFVQIGLAANSGVFKEIVETNRPGEIVIDAHCRTNVPGIY
AAGDVSTVPFKQIIISMGEGAKAALSAFEDRVRGVLG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaatcaacattaaaagaacaattaaaaggtatattcgcagggttaaatgcgaat
tatacctttgatatatcgatctctcctgcgcatgaaagtagacaagagttgttggattta
ttaggtgatgttgcctcttgttcggataaaatatctatgcgagtatctgatggggatgga
ttggaattcattttattaaaggatggagcgaaaacggggattaagtttcgtggagtacct
aatggacacgagtttacttccttgctgttggcgatcttgaattcagatgggaaaggcaag
aattttccggacgagagtatttgtaatcgtgttaaagccttgaatggctcgatacatctg
acgacctatgtctctttgacttgtacgaattgcccggatgtggtacaggcattaaacgct
atgacgactttaaatcctcagatccatcatgagatggtagatggggctatcaatcaggcg
gaagttgatgccttgaagatacaaggcgtcccctctgtctttgcggatggaaaactgatc
catgtaggacgtggggaattcggtgaattgttatcgaagctggaagctcagtatggaatc
aatgagagcctgacggagaagacggtaaaacgatatgacgtggttgtggtcggtgggggt
ccggctggtgcttctgccgctatttattccgcacgaaaggggctgagtgtcgctgtcgtg
gcggagcgtatcggcgggcaggtgaaggagacggtaggaattgagaatctgatttcagtt
ccggagacaacaggtacccagttggctgacaatctgcgcttgcatatgcggcaatatccg
attgacctgctggagcatcgtcgtatagagaaggtaacgatagaaggaaacgagaaggtt
ttatctacggctggaggtgagatattcaaggctccggcggttattgtcgctacgggcgct
agctggcgtaaattgaatgtaccgggtgaggcagagtatatagggcgtggagtggctttt
tgtcctcattgcgacggtccgttttataagggaaaacatgttgccgtggttggcggtgga
aattccggtatcgaggcggctattgatttggcggggatctgttcgaaagtaaccgttttg
gagtttatggatgagttaaaagcggatcaagtcttgcaagagaaagcgaagagtttgccg
aatgtcgagatctttgttagttcacaaacaaccgaggtggttggaaatggcgacaaggta
accggtatccgtacaaaggatcgtaagacaggggaagagcgtgttattcatttagacggt
atttttgttcaaatcggcttagccgctaatagtggtgtctttaaggagattgtcgaaaca
aatcgtcccggtgagatcgtgattgacgcacattgccggacgaatgtcccgggtatttat
gcagcgggcgacgtttccaccgtaccctttaagcaaatcattatttctatgggagaaggc
gccaaagcggccctttcggcctttgaagatcgggtacgtggtgtactcggttga

DBGET integrated database retrieval system