Pyrofollis japonicus: PYJP_17480 Help Entry PYJP_17480        CDS       T09484                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism pare  Pyrofollis japonicus Pathway pare00010   Glycolysis / Gluconeogenesis pare00020   Citrate cycle (TCA cycle) pare00620   Pyruvate metabolism pare00633   Nitrotoluene degradation pare00640   Propanoate metabolism pare00650   Butanoate metabolism pare00680   Methane metabolism pare00720   Carbon fixation pathways in prokaryotes pare01100   Metabolic pathways pare01110   Biosynthesis of secondary metabolites pare01120   Microbial metabolism in diverse environments pare01200   Carbon metabolism pare01210   2-Oxocarboxylic acid metabolism Module pare_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:pare00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     PYJP_17480    00020 Citrate cycle (TCA cycle)     PYJP_17480    00620 Pyruvate metabolism     PYJP_17480    00640 Propanoate metabolism     PYJP_17480    00650 Butanoate metabolism     PYJP_17480   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     PYJP_17480    00680 Methane metabolism     PYJP_17480   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     PYJP_17480 Enzymes [BR:pare01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      PYJP_17480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_21 Fer4_10 Fer4_2 Fer4_9 Fer4_16 Fer4_8 Fer4_17 Fer4_15 Fer4_4 Fer4_13 Fer4_22 Fer4_3 Motif Other DBs NCBI-ProteinID:  BEP18396 LinkDB All DBs Position complement(1691677..1692021) Genome browser AA seq 114 aa AA seqDB search MSESKKGIVARIDPGGHKLPLSMAAPGSMGRTGYWRTERPVVNYDKCTGCYLCWLYCPEN VIEMVPKKGPRGQDIPVIDYDYCKGCGICAAVCPVKAIEMVDESKFIEQEESEG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtccgagtccaagaagggtattgtagcccgtatagacccgggtgggcacaagcttccc ttatcaatggctgctccaggctctatgggtaggacgggctactggagaactgagagacca gttgttaactacgacaagtgtactggctgctacctctgttggctctactgcccggagaac gtgatagagatggttccgaagaaggggcctaggggccaggacatcccggtaatagattat gattactgcaagggctgcggcatatgtgcagcagtttgccccgtcaaggctatagaaatg gttgatgagtcgaagttcatagagcaagaggagagtgaggggtga

DBGET integrated database retrieval system