KEGG   Pseudoalteromonas atlantica: Patl_2297Help
Entry
Patl_2297         CDS       T00372                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pat  Pseudoalteromonas atlantica
Brite
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Patl_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABG40814
UniProt: Q15TH4
LinkDB All DBs
Position
complement(2798796..2799338)
Genome map
AA seq 180 aa AA seqDB search
MKKFLLPVLVGSISLALSATSIAAHHDEGKKVVMNNLETGESIGNVMVKDYDDDGVVFTP
NLSGLTPGVHGFHIHQNGDCSASMKDGKKVLGGAAGGHYDPEDTDKHSVPWSEEGHEGDL
PTLVVDEKGNATQPVFAPELELDDIEGRAIMIHAGGDNYSDSPKALGGGGERVACGVIPQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttttattaccagtactagtgggatcgatctctttggctcttagcgcaaca
agcattgccgcccatcatgatgagggtaaaaaagtagtgatgaataacctggaaaccggt
gaaagcatcggcaacgtgatggttaaggattatgatgatgatggcgtggtgtttacacct
aacttaagtggtttaacaccgggtgttcacggttttcatattcatcaaaatggcgactgt
tctgcgtcgatgaaagacggcaaaaaagtgttaggcggtgcagccggaggacactatgac
ccagaagataccgataagcacagcgtgccttggtcagaagaaggccacgaaggggattta
ccgacgttggttgttgatgaaaaaggtaacgctacccaaccagtattcgctccagagtta
gaattggatgacatagaaggccgtgcaatcatgatccacgcgggtggcgacaattattct
gattcacccaaagcactaggtggcggcggcgagcgtgtcgcgtgcggggttatcccacaa
tag

DBGET integrated database retrieval system