KEGG   Photorhabdus asymbiotica: PAU_00133Help
Entry
PAU_00133         CDS       T00941                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00564  Glycerophospholipid metabolism
pay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAU_00133 (glpD)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PAU_00133 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored GIDA Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: CAQ82226
UniProt: C7BGP7
LinkDB All DBs
Position
complement(144497..145999)
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLAKATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLNLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDNLGKRVSLPSS
KGLKFGANSVLKPELVRGFEYSDCWVDDARLVVLNAQEVKKHDGEVRTRTKVTRAWREHD
GWMVEAEDLRTGKTHTWRAKGLVNATGPWVKEFFDDSLKLKSPYGIRLIKGSHIVVPRVH
DEPQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYTGDPKEVKIDDQEINYLLKVYNAHF
KKQLSREDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDEQGKAPLLSVFGGKLTTYRK
LAEHATEKLMQYYPNAGKAWTKNGQLPGGNLEGCDRDGYARLLRKRYNWLPEGVAVRYAR
TYGSHSELILQSANNLADLGKSFGHGLYEAELRYLVDNEWVVELDDAIWRRTKLGMWLNE
EQKQHVAAWLVENAKPRSEI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgttatcggcggcgggatcaacggcgcaggtattgcggct
gatgccgctggccgggggctctccgttctgctgctggaggcacaagacttagccaaagcc
acttcatccgccagttcaaaactgatccacggtggcctgcgctatctggaacattatgaa
ttccgtctggtcagcgaagcgctggcagaacgtgaagttctattgaatctcgcaccacac
atcgcttttccaatgcgtttccgtctgccgcaccagccacacctgcgcccggcatggatg
atccgcattggcttgttcctctatgacaatttaggtaaacgtgtcagcctaccaagcagt
aaggggctgaaattcggtgctaattccgtgttgaaaccagaattggtccgtggctttgaa
tactctgactgctgggttgatgatgctcgtttagttgtccttaacgcccaggaagtgaaa
aaacacgacggtgaagtccgtactcgaacaaaagtgactcgcgcatggcgcgaacatgac
ggttggatggttgaagccgaagatctgcgtacaggtaaaacccatacctggcgcgcaaaa
ggtttggttaatgcaacgggtccttgggttaaagaattctttgacgatagcctgaaactg
aaatcaccttatggtattcgtctgatcaaaggcagccatattgtggtaccaagagtgcat
gatgagccacaagcttatattctgcaaaacgaagatcatcgtatcgtatttgttattccg
tggatggatgaattctccattattggtacaaccgatgtcgaatatacaggtgatccaaaa
gaggtgaagatagacgatcaagagattaactatctgttgaaagtctataatgctcatttt
aagaaacagcttagccgtgaagatatcgtttggacctattctggcgtccgcccactgtgc
gatgacgagtctgattcacctcaggcaatcacccgtgactacacgctcgatattcatgat
gagcagggtaaagccccattactatctgtgtttggtggtaagttaaccacttaccgtaag
ctggcagagcacgcaaccgagaagctcatgcaatattatcctaatgctggaaaagcctgg
accaaaaatggtcaattaccggggggtaatctggaagggtgcgatcgtgatggttatgcc
cgtttactacgtaaacgctacaactggttaccggaaggtgttgctgtacgttatgcacgt
acttacggcagtcacagcgaactgattctgcaaagtgctaataatctggcagatctgggt
aaatccttcggtcacggactgtatgaagcagagcttcgttatctggttgataatgagtgg
gttgttgaactggatgacgcaatctggcgccggaccaaattgggtatgtggctgaatgaa
gagcagaagcagcacgttgcagcatggttggtggagaatgctaaaccacgtagcgagatt
tga

DBGET integrated database retrieval system