KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a178
Entry
PSEBR_a178        CDS       T01472                                 

Definition
(GenBank) Putative Stearoyl-CoA 9-desaturase (Fatty acid desaturase)
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba01040  Biosynthesis of unsaturated fatty acids
pba01100  Metabolic pathways
pba01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSEBR_a178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pba01004]
    PSEBR_a178
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PSEBR_a178
Lipid biosynthesis proteins [BR:pba01004]
 Desaturase
  First
   PSEBR_a178
SSDB
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Other DBs
NCBI-ProteinID: AEA66311
UniProt: F2KD49
LinkDB
Position
complement(213008..214195)
AA seq 395 aa
MWYEGFLGLSAWSLVAVTLLMTHVTIIAVTVYLHRYSAHRSLELNAGLKHFFRFWLWLTT
AQNTREWTAIHRKHHAKCETVDDPHSPVIKGLSTVLRKGAELYRAEAENPETLRIYGKNC
PDDWIERNLYSRFPLLGVAIMGVIDLLLFGTIGITIWAIQMMWIPVWAAGVVNGLGHAVG
YRNFECRDAATNLVPWGILIGGEELHNNHHTYPNSAKLSVRKWEFDLGWAWIRVFSVLRL
AKVQRVAPIAHRVEGKGHLDMDTAMAILNNRFQIMAQYRRLVIAPLVKQELEKVDHSVRH
QFHRAKRLLSRETSLLDDRHHVRIQNMLEHSQALKVIYEKRLALQQIWVKTSSNGHDMLA
AIKEWVHEAEASGIQSLRDFADQLKTYSLRPATAL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtggtacgaaggttttcttggcttgtcggcctggtcactggtggcagtcaccctgctg
atgacccacgtcacgatcattgccgtcacggtctacctgcaccgttattcggcgcaccgc
tccctggagctcaatgcgggtctcaaacatttcttccgtttctggctgtggctgaccaca
gcgcagaacacccgcgagtggaccgccatccaccgcaagcaccacgccaaatgcgaaacc
gtcgacgacccccacagcccggtcataaaaggcttgtccaccgtgctgcgcaaaggcgcc
gagctgtatcgcgccgaggcggaaaatccggaaaccctgcgcatctacggcaagaactgc
cccgacgactggatcgagcgcaacctctacagccgcttcccgctgctgggcgtggcgatc
atgggcgtcatcgacctgctgctgttcggcaccatcggcatcaccatctgggccatccag
atgatgtggattcccgtgtgggccgccggcgtggtcaacggcctgggccatgccgtgggc
taccgcaacttcgaatgccgcgatgcggcgaccaacctggtgccctggggcatcctgatc
ggcggcgaagaactgcacaacaaccaccacacctaccccaactcggccaagctgtcggta
cgcaaatgggagttcgacctgggctgggcctggatccgggtgttcagtgtcctgcgcctg
gccaaggtccagcgggttgcgccgatcgcccaccgggtcgaaggcaagggccacttggac
atggacacggccatggcgattctcaacaaccgtttccagatcatggcgcagtaccgccgg
ctggtcatcgcgccgctggtcaagcaggaactggaaaaggtcgatcactcggtgcgtcat
cagttccaccgggccaaacgcctgctgtcgcgggaaaccagcctgctggacgaccgtcac
cacgtgcgcatccagaacatgctcgaacacagccaggcgctgaaggtgatctacgagaaa
cgcctggccttgcagcagatctgggtcaagaccagcagcaacggccacgacatgctcgcc
gccatcaaggaatgggtccacgaggccgaggccagcggcatccagtccctgcgggacttc
gccgaccagctcaagacctactcgctacggcctgccacggccctgtag

DBGET integrated database retrieval system