KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3435
Entry
PSEBR_a3435       CDS       T01472                                 

Definition
(GenBank) putative lysine decarboxylase
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00230  Purine metabolism
pba00240  Pyrimidine metabolism
pba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PSEBR_a3435
   00240 Pyrimidine metabolism
    PSEBR_a3435
Enzymes [BR:pba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     PSEBR_a3435
    3.2.2.-  
     PSEBR_a3435
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AEA69759
UniProt: F2KIG3
LinkDB
Position
4234998..4236371
AA seq 457 aa
MTQRHVINASVSPKGSLETLSQREVQQLSEAGSGSIYTLFRQCALAILNTGAHVDNAKTI
LEAYKDFEIRIHQQDRGVRLELLNAPADAFVDGEMIASTREMLFSALRDIVYTENELDSQ
RIDLSSSQGISDYVFHLLRNARTLRPGVEPKIVVCWGGHSINTEEYKYTKKVGHELGLRS
LDICTGCGPGVMKGPMKGATIAHAKQRIHGGRYLGLTEPGIIAAEAPNPIVNELVILPDI
EKRLEAFVRVGHGIIIFPGGAGTAEEFLYLLGILMHPANQDLPFPVVLTGPKSAAPYLDQ
LHAFVGATLGEEAQKHYQIIIDDPAEVARQMTQGLKEVKQFRRERNDAFHFNWLLKIDEG
FQRPFDPTHANMASLGLSRDLPAHELAANLRRAFSGIVAGNVKDKGIRLIEEHGPYEIHG
DAAIMEPLDRLLQAFVAQHRMKLPGGAAYVPCYRVVT
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgactcaaagacatgtaatcaacgcctcggtaagccccaagggcagcctggagaccttg
tcccagcgcgaagtccagcaactgagcgaagccggttccggcagtatctataccctcttc
cgccagtgcgccctggccatcctcaacaccggcgcccatgttgataacgccaagaccatc
ctggaagcctacaaggacttcgagatccgtattcaccagcaggaccggggcgtgcgcctg
gagctgctgaacgcgccggccgatgcgttcgtcgacggcgaaatgatcgccagcacccgg
gaaatgctgttcagcgccctgcgcgacatcgtctacaccgagaacgagctggacagccag
cgcatcgacctcagctcgtcccagggcatcagcgactacgtgttccatctgctgcgcaac
gcccgcaccttgcgtccaggcgtggagccgaaaatcgtcgtgtgctggggcggtcactcg
atcaacaccgaagaatacaaatacaccaagaaggtcggccacgaactgggcctgcgcagc
ctggacatctgcaccggttgcggccctggcgtgatgaaaggcccgatgaaaggcgccacc
attgcccatgccaagcagcgtatccatggcggtcgctacctgggcctgacggaaccgggc
atcatcgccgccgaggcgccgaacccgatcgtcaatgagctggtgatcctgccggacatc
gagaaacgcctcgaggctttcgtgcgtgtcggtcacggcatcatcatcttcccgggcggc
gccggtacggcggaagagttcctgtacctgctgggcatcctgatgcacccggccaaccag
gacctgccgttcccggtggttctcaccgggccgaaaagcgccgcgccgtacctcgatcag
ttgcatgcgtttgtcggtgcaaccctgggtgaggaggcgcagaagcactatcagatcatc
atcgacgacccggccgaagtggcacggcagatgacccaggggctcaaggaggtcaagcag
ttccgccgcgagcgcaacgacgccttccacttcaactggctgctgaagatcgacgagggc
ttccagcgcccgttcgacccgacccacgccaacatggccagcctgggcctgagccgcgac
ctgcccgcccacgaactggccgccaatctgcgccgggcgttctcgggaatcgtggccggt
aacgtcaaggacaagggcatccgcctgatcgaagaacacggcccgtacgaaatccacggc
gacgccgccatcatggaacccctcgatcgcctgctccaggccttcgtcgcccagcaccgc
atgaaactgccgggcggcgcggcgtatgtgccgtgctatcgcgtggtgacctga

DBGET integrated database retrieval system