KEGG   Pogonomyrmex barbatus (red harvester ant): 105427823
Entry
105427823         CDS       T04903                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00230  Purine metabolism
pbar01100  Metabolic pathways
pbar04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105427823
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105427823
Enzymes [BR:pbar01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105427823
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 105427823
NCBI-ProteinID: XP_011638073
UniProt: A0A6I9W8F9
LinkDB
Position
Unknown
AA seq 1005 aa
MSQRQQTPTNEDSYLSCGRPSNLLKTSFSSARLEKLYRASSLQQRRGGLTCFLMSAILYG
VYTVSMPGLELPARGVSAVFLSLNIVLLVWAERGTKARNSLWSVVPCIVGQLWIVHLPAQ
LFLKSTKVTPRDGLGWMLLLLYLLFATLPLKLCRCTSLALGSVLVYFVAVIGLSSTTLEE
LKTQPIDVLILTVTLFAGAAILGACGYCLAEFQQRRAFLETRQSLEVQLMIEEQSAEQER
LLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELV
KILNELFARFDQLSERYEQLRIKILGDCYYCISGAPVERPDHAVLCVYMGLSMVEAIKYV
QQTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGRAGRVHISNATL
SFLNGEFEVEPAHGEDREEALQKAGLVTYFIVRALKPFKPAVTKSLASLADAENSQKIIE
NVQDRGDNSREDSEEFQQRLRKKLDSRGGGTDLKGHASWLTLRFKDPNVETAFHSVEEAF
SPLSLLGGPLVTMCAAPVWRLQPWGPFTWGGAGVVTLFGIVLAGATCLGSAVRATWLRST
LALLMTFSLIIFLLLDMTNCAIIDDIEPPKNTSLNWSPRCPYPSYYSYIGVLALIAISMP
TYLCYLTKACLIYFLVGAQSCINVLFLASSLDREDVTSNQSGLMAFPLKYSLAATLFVIA
TTLIIVARYAETARRMLYLRGREVIAQRERAADMKRRNGALIYNILPTHVATYFLSHARH
HDDLYSQSYAEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQKKFKS
IIKIKTIGSTYMAASGITEVQSVQSEDGPRWGHLVTLVEFALELKKALSSINEQSFNHFV
LKMGINHGPVIAGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRKILEPFGFG
FEQRGLVFVKGKGQLLTHYLVSKDGVFLDLDSDLPVEPTHPIIYQ
NT seq 3018 nt   +upstreamnt  +downstreamnt
atgtcgcagcgacaacaaacgccgaccaacgaggattcttacctgagctgtggcaggccg
tcaaacttactgaagaccagcttcagcagcgcccgtctcgagaagctctatcgcgcctcg
tcgttgcagcagcgtcgcggtggcctcacgtgcttcctgatgtcggcgatcctgtacggc
gtctacacggtgtcaatgccggggctggagttgccggcgcgtggcgtcagcgccgtgttc
ctcagcctgaacatcgtcctgctggtctgggccgaacgcggcaccaaagcacgtaactcg
ctgtggtccgtggtgccgtgcatagtcggacagctgtggatcgtccacctgcccgctcag
ctgttcctcaagtccaccaaggtcacgccgagggacggcctaggttggatgctgctgttg
ctgtacctgctcttcgccaccttgccgctcaagctgtgccgctgcacgtctctcgcgctc
ggcagcgtgctcgtatatttcgtcgctgtgatcggtctgtccagcacgacgttggaagag
cttaagacgcagcccatcgacgttctgatcctgacggtgacgctcttcgccggcgccgct
attttgggcgcttgcggatactgcctggcggagttccagcagcgtcgtgcgttcctggag
accaggcagagcttggaggtccagctgatgatcgaggagcagagcgccgagcaggagcgg
ctgctgctcagcgtcctgccggagcacgtcgcggtcaagatgcggcaagacctcggggcg
tccctcgacacgcagttcaagaagatctacatgtccaggcatgagaacgtgtcgatactt
tacgccgacatagtcggcttcaccgcgatctcctcgacttacagcgccagcgagctggtc
aagatactcaacgagctcttcgcgcggttcgatcaacttagcgaacgatacgaacaactg
cgcataaaaatcttgggggattgttactattgcataagtggtgctcccgtggaaaggcca
gaccacgcggtcctctgcgtgtatatggggctgtccatggtggaggcgattaaatatgtt
caacaaacgacgaacagccccgtcgacatgagagtgggtattcacacgggtgcggtactc
gctggggtcctcggacagagacaatggcaattcgacgtttacagcaaagacgtcgagcta
gcgaacaaaatggagagcagcggaagggcagggagggtacacatctcgaatgcgacgttg
agcttcttaaatggggaattcgaggtcgagccggcgcacggggaggatcgggaagaggca
cttcaaaaggctggcctcgtcacttactttatcgtaagggccttgaagccatttaagccg
gcggtgacgaaaagcctcgcgtcgctggcggatgcggaaaactcgcaaaaaataatagag
aacgtgcaagacaggggggacaatagtcgggaggactccgaagaatttcagcaacgtttg
aggaagaaactcgacagtagaggtggtggtaccgacctgaaaggtcatgcctcctggttg
accttacggttcaaggatccgaacgtggagacggcattccatagcgtcgaggaggccttt
tcacccttatcgcttcttggcgggcctctggttacgatgtgcgcggctccagtctggagg
ttgcagccttggggaccgttcacgtggggtggcgcaggggtggttactctcttcggcatc
gtgttggctggagccacctgcctgggcagcgccgttagggcgacgtggctcagaagcacc
ctcgcacttcttatgacattctccctcataatcttcctgttgctagacatgaccaactgt
gcgatcatcgacgatatcgaaccgccgaaaaacacttcgctgaattggtccccgcgatgt
ccatatccttcttattattcatatatcggtgtcctcgcgctgatcgctatttcgatgcca
acgtatctctgttacctgaccaaggcgtgcctgatatatttccttgtcggcgcgcagtcc
tgcattaatgtcctgttcctcgcatcgagtctcgacagagaagatgtgacgtcgaaccag
tccggacttatggcctttccactgaaatattctctggcagccactttgttcgtcatcgcg
actaccctaattattgtggcaagatatgccgagacggcgcgaaggatgttgtacctgcga
ggacgagaggtgatcgcacagcgggaacgagcggcagacatgaagcggagaaacggcgcg
ctgatatacaacatcctgccgacacacgtggccacttatttcctgtcgcacgcgaggcac
cacgacgatctttatagccagagctacgccgaggtgggcgtgctgttcgccagcatgccc
aattttgcggacttctacagcgaggagagcataaacaatcaaggcctcgagtgcctcaga
tttctgaacgaagtcatctccgacttcgacgccatcctcgatcagaagaagttcaagagc
atcattaagatcaagacgatagggtcgacctacatggcggcctcgggaataaccgaggtg
cagtcggtgcagtcggaggacggtcctcggtggggtcacctcgtcaccctcgtggaattc
gctctggagcttaagaaagctctgtcaagcatcaacgagcaaagctttaatcacttcgtt
ctaaagatgggtattaatcatggaccggtgatcgccggtgtcatcggggcacggaaacct
cactacgatatttggggcaacaccgtcaacgtcgcgtcgaggatggagagcacaggaaaa
gtcggctgcattcaggttaccgacgagacgcggaagattctggaaccgtttggttttggc
ttcgagcagcgaggtctcgttttcgtcaagggcaaagggcagctcttaacgcattatctt
gtctccaaggatggcgtctttctcgatctcgacagcgatctgcccgttgaacctactcat
ccgataatctatcaataa

DBGET integrated database retrieval system