KEGG   Phycisphaerae bacterium SM-Chi-D1: SMSP2_01033Help
Entry
SMSP2_01033       CDS       T04749                                 

Gene name
gutB
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pbas  Phycisphaerae bacterium SM-Chi-D1
Pathway
pbas00040  Pentose and glucuronate interconversions
pbas00051  Fructose and mannose metabolism
pbas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SMSP2_01033 (gutB)
   00051 Fructose and mannose metabolism
    SMSP2_01033 (gutB)
Enzymes [BR:pbas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     SMSP2_01033 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AQQ70676
UniProt: A0A1Q2MDA8
LinkDB All DBs
Position
complement(1337600..1338634)
Genome map
AA seq 344 aa AA seqDB search
MKAMRLTGIRQMEMLETPDPQIVDDTDVLIRMKVVGICGSDVHYYTTGRIGDQVCEYPYT
VGHESAGVVEAVGPAVTSVKPGDRIAVEPAVSCGKCDQCLSHRSHTCRNLKFLGCPGQIE
GCLSEYIVMPQECCYKIPDDMTLDQAAVSEPLSIGFYAVKQSIDIKCKTAAILGAGPIGL
SVLLAAKYMEAGKIYMTDKIDARVDTALQNGADWAGNPDSQNIVKEISQAEPLLLDCVFE
CCGEQEAIDQAVELLKPGGKLMFVGIPEVDRISFDISKIRRKEICIQNVRRQNECVQETL
DMIHSGKVSADFMVTHRFDFADSKKGFDMVDNYEDGVIKAMIDL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatgcggcttaccggaatacgtcagatggagatgcttgagactccagacccg
caaatcgttgatgacacagacgtgcttatacgcatgaaggtcgttggaatctgcggcagt
gatgttcattactacactaccggcagaataggcgatcaggtatgcgaatatccctacacc
gtcggccacgaaagcgctggggtcgtcgaagctgtcgggcctgctgtgacgtcggtaaag
cccggcgacagaatagctgttgagccggctgtctcctgcggtaagtgcgatcagtgcctc
tcgcatcgcagccatacctgccgcaatctcaaattcctcggctgtcccggccagattgag
ggctgcctgagcgaatacattgtaatgccgcaggagtgctgctataagataccagatgat
atgactcttgatcaggctgccgtttctgagccgctctctatcggtttttacgcggtcaaa
cagtctatagatatcaagtgcaaaaccgccgctattcttggcgcagggcctatcggtttg
agcgttcttctcgcagctaaatacatggaagcgggcaaaatctatatgactgacaaaatt
gatgccagagtggatacggcactccaaaacggagccgactgggcgggcaaccctgactct
caaaatattgtaaaggaaatatcccaggcagagccgctgctgcttgattgtgtgtttgag
tgctgcggagagcaggaagctattgaccaggcggtagagctgctcaaacccggcggtaaa
ctgatgtttgttgggataccggaagttgatcggatttcgttcgatatcagcaaaatccgc
cgcaaggagatatgtattcagaacgtacgcaggcagaacgaatgtgtgcaggaaacactg
gatatgattcattcgggcaaagtcagtgcagattttatggtaacacatcggtttgatttt
gccgattcgaagaaaggcttcgacatggttgataattacgaggacggggttataaaggcg
atgattgatctctaa

DBGET integrated database retrieval system