Python bivittatus (Burmese python): 103065743 Help Entry 103065743         CDS       T03091                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism pbi  Python bivittatus (Burmese python) Pathway pbi04010   MAPK signaling pathway pbi04012   ErbB signaling pathway pbi04068   FoxO signaling pathway pbi04137   Mitophagy - animal pbi04140   Autophagy - animal pbi04144   Endocytosis pbi04150   mTOR signaling pathway pbi04210   Apoptosis pbi04218   Cellular senescence pbi04370   VEGF signaling pathway pbi04371   Apelin signaling pathway pbi04510   Focal adhesion pbi04540   Gap junction pbi04625   C-type lectin receptor signaling pathway pbi04810   Regulation of actin cytoskeleton pbi04910   Insulin signaling pathway pbi04912   GnRH signaling pathway pbi04916   Melanogenesis pbi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103065743 (HRAS)    04012 ErbB signaling pathway     103065743 (HRAS)    04370 VEGF signaling pathway     103065743 (HRAS)    04371 Apelin signaling pathway     103065743 (HRAS)    04068 FoxO signaling pathway     103065743 (HRAS)    04150 mTOR signaling pathway     103065743 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103065743 (HRAS)    04140 Autophagy - animal     103065743 (HRAS)    04137 Mitophagy - animal     103065743 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103065743 (HRAS)    04218 Cellular senescence     103065743 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103065743 (HRAS)    04540 Gap junction     103065743 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103065743 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103065743 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103065743 (HRAS)    04912 GnRH signaling pathway     103065743 (HRAS)    04916 Melanogenesis     103065743 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103065743 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbi04131]     103065743 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pbi04147]     103065743 (HRAS)    04031 GTP-binding proteins [BR:pbi04031]     103065743 (HRAS) Membrane trafficking [BR:pbi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103065743 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103065743 (HRAS) Exosome [BR:pbi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103065743 (HRAS)   Exosomal proteins of colorectal cancer cells    103065743 (HRAS) GTP-binding proteins [BR:pbi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103065743 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  103065743 NCBI-ProteinID:  XP_025026641 UniProt:  A0A9F5J7P1 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaaactggtggtggttggtgcaggaggcgttgggaaaagtgcactgact attcagcttattcagaatcattttgttgatgagtatgatcctaccatagaggattcctac agaaagcaagtagtcattgatggggagacctgcttattggacattttggacacagctggc caagaggaatacagcgccatgcgagaccagtacatgcggacaggagaaggcttcctatgt gtcttcgctattaacaacaccaaatcctttgaagacattcatcagtatagagagcagatc aagagagtgaaggactctgatgatgtgcccatggtgttggtggggaataagtgtgacctt cctgcccggactgtggaaacgcggcaagcccaggagctggctcggagctatgggattcca tatatagagacatcagccaaaactagacagggagtcgaagatgccttctatactttagtg cgggagatccggcagcacaaactacgtaaattgaatcctccagatgaaagtggtccaggc tgcatgaactgtaaatgtgtaatatcatga

DBGET integrated database retrieval system