KEGG   Python bivittatus (Burmese python): 103066913
Entry
103066913         CDS       T03091                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04068  FoxO signaling pathway
pbi04110  Cell cycle
pbi04115  p53 signaling pathway
pbi04218  Cellular senescence
pbi04310  Wnt signaling pathway
pbi04340  Hedgehog signaling pathway
pbi04371  Apelin signaling pathway
pbi04510  Focal adhesion
pbi04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103066913 (CCND1)
   04340 Hedgehog signaling pathway
    103066913 (CCND1)
   04371 Apelin signaling pathway
    103066913 (CCND1)
   04068 FoxO signaling pathway
    103066913 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103066913 (CCND1)
   04115 p53 signaling pathway
    103066913 (CCND1)
   04218 Cellular senescence
    103066913 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103066913 (CCND1)
   04530 Tight junction
    103066913 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103066913
NCBI-ProteinID: XP_007425592
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSFEPIKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPNELLQMELLLVNKLKWNLAAMTPHDFIEHFLNKMPVAEDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNSFLSYQCLTPFLSKVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEEEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctctgctgtgaagtcgagaccatccggagagcgtaccaagatgcc
aacctcctcaatgacagggtcttgcagactatgctgaaggcggaggagacttgctcgccc
tcggtctcctacttcaagtgcgtgcaaaaggagatcttaccatatatgaggaaaatagtg
gccacttggatgttggaggtttgtgaggaacagaaatgtgaagaggaggttttccccttg
gcgatgaattatttggaccgatatctctcttttgaacccatcaagaaaagccgcttgcaa
ctacttggagctacctgtatgtttgtggcttcaaaaatgaaggaaactattcctctaaca
gcagaaaaactgtgtatttacactgataactccattagacctaatgaattactgcaaatg
gaactgcttctggtgaataagctgaaatggaatctggctgccatgactcctcacgatttt
attgaacattttctaaataaaatgcctgtggctgaggacagcaagcagatcatccgtaaa
cacgcccagacttttgtggctctctgtgcaacagatgttaagtttatttcaaacccacct
tccatgatcgcagccggtagtgtggtagcagctgtgcaaggtcttcaccttggaaacact
aattcttttctctcttatcaatgcctcacacctttcctatcaaaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatctctccttgaatctagtcttcgc
caggcacaacaacacaacatatcttcagaaacaaagactgttgaagaggaagctgatctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system