KEGG   Paracoccidioides lutzii Pb01: PAAG_08605Help
Entry
PAAG_08605        CDS       T02230                                 

Definition
(RefSeq) histone deacetylase HosB
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PAAG_08605
Chromosome and associated proteins [BR:pbl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PAAG_08605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 9092706
NCBI-ProteinID: XP_002789501
UniProt: C1HCW4
LinkDB All DBs
Position
Unknown
AA seq 1179 aa AA seqDB search
MDRSHRDHPGSPSPAARLQGRLSTKHADKLASSFTRLPIATGSVIVGPSSSPSPSPYQSP
SRFVDRNTPFSRHNSPSRALANHPSVPRRNPSTSSLREERRGSTPSLQKRSSVSSLRSVQ
NYSRNGVTPQRPSLSRPASSNFLSTTSSSMRPKSPLAGPDSPIQPLLPTASSIANSHFKK
ELALHQSADLHSKTLVIVQDACYGHRFSRPRTSKASLEQIVERPERLLASVLGVSTAYIR
MGRRYDDGQFAPHPDLDLRSLPIPPFQVRKTTRTMPINSPAVTHVHGIKWMDELRVMCYA
AESRLALNGKELVRPSSSGKDNNSSSSLPKLHEGDLYLCSESLNAFEGALGGVCEAVDVV
FGPTSTTRAFVSIRPPGHHCSADYPSGFCWLNNVHVGITHAAMSHGLTHAAIIDFDLHHG
DGSQEITWEQNRKAKTASKNAPLHKKMTIGYYSLHDINSYPCENGDLNKVRNASLCIDNA
HGQSIWNVHLEPWKSSASFWELYNKKYTILLEKARKFLRSHTLRLLNSQNPAPPKAAIFI
SAGFDASEWEGVGMQRHKVNVPTDFYAKFTSDIVRMSEEEGLGVDGRVISVLEGGYSDRA
LISGVLSHLSGLADSQTSIYENGDNRLAAEMLGRLGLNDVPEAVSEESSSFDTEWWKLPL
LEEIERLANPLPPAPTRKSHEKSPPTYCSPTQASAAKIVIPSRDRRSISSQLSAGDGGYM
RPPLPAIDWATAAYEMSKILIPTDRQTVSFQHAELKAEGARTRPDRHSTSNISELQPVDD
RRSMQLRERKLKSPSPELQIAGRSSQTSRRTTIASISDLPETSTVTSSASSNQNLNHVYS
RNSRRLSVASTVASTIGGNPSKASVEGTSPTSSNGDCDRTLNSRPGTSNGKPADLVTVKK
SRVTGVRSSPRKAAPPPQARAIGGSPIPPFDSSSINTDTAERELTKLSVGIKKLSIKLKV
PSPEEHAAREEERLKVSANKFTSRKTRKTQAPKKSGSRSTKSSAKTLRPGTALGEASAPP
VVLSAASGPVKQEAGSPTALANPDIEMIHTPDLTTTPFSAKLNNGAAISGWPSESGMQQT
QQKPSKRLSPDGTFTPHISHSLTPRSLGNSQQPQITVKPPPTSRGYKPATQQQQQQQQQQ
TTNIQLPVFTSTSAIPFATSSAVSSAAPPGPRQENRREQ
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atggaccggtctcatcgagaccaccccggcagcccgtctcctgcggccaggctccaaggg
aggctgtcaaccaaacacgcggacaaactggcaagctcctttactcgcctcccaattgca
acaggttctgttatagtcggtccatcctcgtcgccttctccttcgccgtaccagtcacct
tctcgtttcgttgacaggaacactcccttttcacgccataactcgccgtcgagagctcta
gccaaccacccgtccgttccccgaaggaaccccagtaccagttcgttgagagaggaaaga
agagggtctaccccgtctctccagaaaagatcatcggtcagctcactacgatctgttcaa
aactatagtagaaatggcgttaccccccagcgacccagcctatcgcgacccgcctcttca
aacttcctttctaccacctcttctagcatgcgccccaagtcccccttagcgggccctgat
tccccgatccagcctttgctgccaaccgcctcctccatcgccaatagccatttcaagaag
gagttggctttgcatcaatccgcggacctgcactccaaaactctcgtcattgtacaagat
gcctgttacggacacaggttttcgcgcccaagaacctccaaggccagcttggaacaaatt
gtcgaacgcccagagcgcttacttgctagtgttctgggtgtatcaaccgcatatattcgc
atgggaaggaggtatgatgacggccagtttgcaccacatccggacctagatcttcggtcg
cttcccatcccaccctttcaagtccggaagacgacgcgcactatgccaattaattcccct
gcggttacacatgtccatggaataaaatggatggatgaactacgagttatgtgttatgcc
gccgaatctcgtcttgcattgaatggaaaggagttggttcgccccagcagttcagggaag
gacaataatagctcatcaagcctaccaaaactccacgagggcgacctgtatttgtgttcg
gagtccctgaatgcttttgaaggtgcgttgggaggagtctgcgaagcggtggatgtcgtg
tttgggccgacgtcgaccactcgcgctttcgtgagcattcgacctcccggtcaccattgt
tcagcagactatccatccgggttttgctggcttaataatgttcatgttggtatcactcat
gctgcaatgtctcatggtctcactcatgctgctatcattgattttgatctacaccacgga
gacggatcgcaggagattacttgggagcagaatcggaaggcaaaaaccgcttcgaaaaac
gcccctctgcacaagaagatgaccatcggctattacagtctgcatgacattaactcatat
ccttgtgaaaacggcgacctgaacaaagttcgtaatgctagcctttgtatcgacaacgcc
catggacagtctatctggaacgtccatctagaaccctggaaaagttcggctagcttttgg
gagctgtataataaaaaatatacaattcttcttgaaaaggctcgaaagtttcttcgttcc
cataccctccgtttgttaaattcacaaaatccggcaccacccaaggcagcaatattcata
tcagcaggtttcgatgctagtgagtgggaaggagttggtatgcaacgacacaaggtcaac
gtacccacggacttttatgccaagtttacttcagatattgtacggatgtcagaagaggaa
ggcctaggtgttgatgggagggttattagtgttctggaagggggatattctgatagagct
ctaatcagtggtgtactcagtcatctctcagggcttgcggacagccagaccagcatttat
gaaaatggagacaaccgcctcgctgctgagatgttgggccgccttggtttgaatgatgtt
cccgaggcggtttcagaggaaagttcttcatttgatactgaatggtggaaacttcctctg
ctagaagaaatagaacgtcttgcaaacccactacctccagccccaactcgcaaatctcat
gaaaaaagccctcctacatattgttctcccacgcaggcgtcagccgccaaaatcgtcatc
ccctcgcgagaccgcagatcaatttcatctcagctaagtgctggtgacggaggctacatg
cgcccacccctcccggccattgactgggcaacggcggcgtatgagatgtcgaaaatcctc
attcctacggaccgccagacagtgagcttccagcacgcggagctgaaggctgagggtgct
cgtacacgaccagaccggcactcaacttcgaatatttcagaattacagcctgttgatgac
cggagatctatgcagttgagggagagaaaactaaagtcaccctcgccggagctacaaata
gccggacggtcttctcaaacttcgcgacgaaccaccattgcatcaatcagcgacctaccc
gaaacatctaccgtcacatcttctgcaagtagcaaccaaaatttgaaccatgtttattct
cggaattcacgacgactaagtgtagcctcgaccgtggcatccactatcggtggaaaccct
agtaaggccagcgtggaaggaacttcaccaacatcttcaaatggggattgcgaccgcacg
ctaaattcacgcccaggaacttcaaacgggaagcctgcggatttggtaacagttaaaaaa
tcccgagttacgggtgtccggtctagtccaagaaaagcggcaccacccccacaagcacga
gcgatcggtggaagcccaattccacccttcgattcatcttctatcaatacggatacagca
gagcgtgaactaactaaactttctgtcggaattaagaaattaagcattaaacttaaagtt
cccagcccggaagagcatgctgccagagaagaggagcgactgaaagttagcgcaaacaaa
ttcacctccagaaagactagaaagacccaggcacccaaaaagtctggatcaagaagcaca
aaatccagcgcgaagacactacgtcctggcaccgcgttgggcgaggcttctgcccctcct
gttgtgctatctgctgcttcgggtcctgttaagcaagaagcgggttcccctacggcactt
gcaaaccctgacattgaaatgatccataccccagatttaacgactacaccattctccgcc
aagttgaataacggggcagctatatctggatggccatccgaatcagggatgcagcagact
caacagaagccttcaaagcgcttgtcgcctgatgggaccttcacacctcatatttcccat
tctctcactcctcgatccctcggaaattcgcagcaaccccaaatcaccgtcaagccaccg
cctacctcgaggggctataagcctgctacccaacagcaacagcaacagcaacagcaacaa
actactaatatacaacttcctgttttcacgtccacttccgctatacctttcgctacttca
tccgccgtttctagcgcggcccctccaggcccacgccaggaaaatcgtcgagagcagtga

DBGET integrated database retrieval system