KEGG   Pseudomonas balearica: CL52_14620
Entry
CL52_14620        CDS       T03573                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00624  Polycyclic aromatic hydrocarbon degradation
pbm00626  Naphthalene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CL52_14620
   00624 Polycyclic aromatic hydrocarbon degradation
    CL52_14620
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     CL52_14620
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     CL52_14620
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase KR DUF608
Other DBs
NCBI-ProteinID: AJE16204
UniProt: A0A1G9QPL8
LinkDB
Position
3127757..3128536
AA seq 259 aa
MSNQQVVSITGAGSGIGLALVRSFKSAGYCVSALVQNEEQKASLCNEFKDALEIVVGDVR
DHATNEKLIKQTTDRFGHLDCFIANAGIWDYMLGIEEPWEKISSSFDEIFNINVKSYFSG
IRAALQELKKTSGSVVMTASVSSHAVGAGGSCYIASKHAVLGMMKALAYELAPHIRVNAV
APGGTVTSLSGPASAGFDKTHMENMPGIEDMIKGLTPLGFAAKAEDVVAPYLLLASRDQG
KFITGTVINIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcaatcaacaagtcgtttcgataaccggtgctggctcaggaattggtctcgcactg
gttcgatcctttaagtccgccggttattgcgtatccgctctcgtacaaaacgaggagcaa
aaggcgagcctttgcaatgagttcaaggacgcactcgagatcgtcgtgggcgatgtccgg
gaccacgcaacaaatgagaagctgataaagcaaacaaccgatagattcggccatctcgat
tgtttcattgcaaatgccggtatttgggattacatgcttggcatcgaagagccttgggag
aaaatatcgagcagttttgatgagatattcaacatcaatgtcaagagctatttcagcggt
atcagggccgccctgcaggaactgaaaaagactagcggatcagtggtgatgaccgcttca
gtgtcgtcccatgcggtcggtgctggtggttcttgctacatcgccagcaagcatgcggtc
ctgggcatgatgaaagctttggcttacgaattggctccccacattcgcgtcaacgccgta
gcaccgggcggcactgtgacgtctctgagcggtcccgcaagcgccggcttcgacaaaact
cacatggaaaacatgcccggtatcgaggacatgatcaagggtctaacgcctcttggattt
gcagccaaggccgaagacgtagtggcaccctatttgttgttggcgtcgcgagatcaaggg
aaattcattaccgggactgtcattaatatagatggagggatggcgctcggtcgcaagtag

DBGET integrated database retrieval system