KEGG   Pseudomonas balearica: CL52_14625
Entry
CL52_14625        CDS       T03573                                 

Definition
(GenBank) dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00626  Naphthalene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CL52_14625
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     CL52_14625
SSDB
Motif
Pfam: Aldedh OmdA
Other DBs
NCBI-ProteinID: AJE16205
UniProt: A0A1G9QQ37
LinkDB
Position
3128584..3130035
AA seq 483 aa
MNTKLFINNVWVNSSDQQTFERKHPVSGEVMTECANSTVMDALKAAQAAQEAFQTWKTVG
PSERRRLLLRVAEVMESKTPEFIEVMAKEVGASALWAGFNVQMSANVFREAASLATQIQG
ETIPTDKSDTLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNAVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFAEKAKRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGATVACGGMAQGAV
MPATILDHVKSNMRIYDEETFGPITVVIRCNGEAEAIRIANDSAYGLSSGVFGRDINRAL
RVGMSIEYGSVHINGSTVQSEAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaatacaaaattgtttatcaacaatgtctgggtcaattccagtgaccaacagaccttc
gagcgaaagcaccccgtcagtggtgaggtgatgacggagtgtgcaaactccacggtgatg
gatgcgttaaaggccgcgcaagctgcccaagaggctttccagacctggaagactgttgga
ccttcggagcgtcgccgccttctgctgagggtcgctgaggttatggaaagtaaaacaccc
gagtttatcgaagtgatggccaaggaggtgggagcctccgctctttgggccggcttcaat
gtccagatgtcagccaatgtgttccgtgaagcggcatcgctggctacacaaattcagggg
gaaactattccgacagacaagtctgacacgctctcaatgacgctacgtcagccggtcggt
ccgatcctgagcatcgtgccgtggaacggcaccgcagtgctggcggcacgagccatcgct
tatccgctggtctgcggcaacgcggtggtattcaaaggttctgagtttagtcccgcgacg
catgccctgatcacccagtgcgtgcaggaagccgggctgcctgctggcgtgctcaactat
ctcaactcttcgcctgaccgttcgcccgagatcgccgacgcactgatctcagccaaggag
atccgacgcatcaacttcacgggctccacccgcgtgggcagtattatcgcgcagaaggcc
gcgcaacacctcaagcgctgcctgctggagctcggtggcaagtccccacttattgttctg
gatgacgcggacatcgacgcagctgtcaaggcagcggtgttcggtagcttcctgttccaa
ggtcagatctgcatgtccactgagcgcttggtggttgatgagaagatcgccgacgaattt
gtcgccaagtttgccgaaaaggccaagcgtttgagcgcgggcgacccatgcgtaactggc
gactgcatcatcggcccaatggtctcgccaaattcaggcgagcggatcaatggtttgttc
aaggacgcgatcgacaaaggagccacagttgcctgcggcggcatggcccaaggtgcggtc
atgccggccacgatcctggatcacgtcaaatccaacatgcggatctacgatgaggagacc
ttcggtcccatcactgtggtgatccgttgcaacggcgaagcagaggccattcgcattgcc
aacgacagcgcctatggcctgtcgtcgggcgtatttggccgcgacatcaaccgtgctttg
cgcgtgggcatgtccatcgaatatggttcagtgcacattaacggatcgactgtccaaagc
gaggcgcaggctccatacggaggcactaagaacactggctacgggcgcttcgacggccgt
gctgtgatcgatgagttcacagagctcaagtggctgaccatcgagcctttcgagcagcag
tatcccttctaa

DBGET integrated database retrieval system