KEGG   Physeter catodon (sperm whale): 102973647
Entry
102973647         CDS       T06011                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04810  Regulation of actin cytoskeleton
pcad04934  Cushing syndrome
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05217  Basal cell carcinoma
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102973647 (APC)
   04390 Hippo signaling pathway
    102973647 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102973647 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102973647 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102973647 (APC)
   05206 MicroRNAs in cancer
    102973647 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102973647 (APC)
   05225 Hepatocellular carcinoma
    102973647 (APC)
   05226 Gastric cancer
    102973647 (APC)
   05217 Basal cell carcinoma
    102973647 (APC)
   05213 Endometrial cancer
    102973647 (APC)
   05224 Breast cancer
    102973647 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102973647 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    102973647 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102973647 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102973647 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102973647 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102973647 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102973647 (APC)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102973647 (APC)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102973647 (APC)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     102973647 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_rep APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 102973647
NCBI-ProteinID: XP_023979633
UniProt: A0A2Y9SMQ3
LinkDB
Position
8
AA seq 2875 aa
MYASLGSGPVAALPASVPPCPLGSWSSGGGRGCVQQERKRRGCVRSSVRGANVWQEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRITRIQQIEKDILR
IRQLLQSQATEAERSSQSKHEASSHEAERQNESQGVAEINMATSGSGQGSTARIDHETAS
VLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
RKATRGISSQELGQGLSGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGD
VANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKAL
MECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAII
ESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNP
KDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSL
HVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYVFDTNRHDDNRSD
NFNTGNMTVLSPYLNTTVLPSSSSSRGSVDSSRSEKDRSLERERGISLVNYHPATENPGT
SSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTPELHCGTDERNALRRSSTAHTHA
NSYNFTKSENSNRTCPVPYAKVEYKRSSNDSLNSVSSSDGYGKRGQMKPSVESYSEDEES
KFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARP
KHIIEDEIKQNEQRQSRSQSTTYPVYPESTDDKHLKFQPHFGQQECVSPYRSRAANGSET
NRVGSNHGINQNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHH
VDQPIDYSLKYTTDIPSSQKPAFSFSKNSSGQSTKTEHISSSSENTSTPSSNAKRQNQLH
PSSAQSRSGQAQKATSSSCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCD
QTTQEADSANTLQIAEIKENSGTRSTEDSVSEVPTVSQHIRTKSSRLQASGLSSESARHK
AVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPC
SGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPPQTAQTKQEVPKNKAPSAEKRESGPKQ
AAVNAAVQRVQVLPDADALLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQ
ENDNGNETENEQPEESNENQGKEAEKPTDSEKDLLDDSDDDDIEILEECIISAMPTKSSR
KAKKPAQTSSKLPPPVARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPI
NFSTATSLSDLTIESPPNELAAGEGVRAGTQSGEFEKRDTIPTEGRSTDEAQTGKASSVT
IPELDDSKTEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASMSSSGTNKNQLDGKK
KKPTSPVKPIPQNTEYRTRVRKNTDSKNNLNAERNFSDNKDSKKQNLKNNSKDFNDKVPN
NEDRVRGSFTFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKENKE
SEAKVTNHTELTSNQQSANKTQAVPKHPINRGQPKPVLQKQSTFPQSSKDIPDRGAATDE
KLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKENEPIKETEPPDSQGEPSKPQASGYA
PKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKADNEKHSPRNM
GGILVEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQA
SSDSDSILSLKSGISLGSPFHLTPDQEEKPFASNKGPRILKPGEKSTLETKKLESENKGI
KGGKKVYKSLITGKVRSNSEVSSQMKQPLQANMPSLSRGRTMIHIPGVRNSSSSTSPVSK
KGPPLKTPASKSPSEGQAATTSPRGAKPSVKSELSPVTRQASQTPGSNKGPSRSGSRDST
PSRPAQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTS
PGRQMSQQNLTKQTGFSKNVSSIPRSESASKGLNQMSTSNGSNKKVELSRMSSTKSSGSE
SDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPILSPSL
PDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPVKRHDIARSHSESPSRLPINRSGTWK
REHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSTSGSKQTKENQVST
KGTWRKMKESEISPTNSTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINN
PRSGRSPTGNTPPVIDTVTEKGNPNTKDSKDNQGKQNVSNGSAPVRTMGLENRLNSFIQV
DAPDQKGTEAKPGQSNPVPASEANESSIAERTPFSSSSSSKHSSPSGTVAARVSPFNYNP
SPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDNTESSGTQSPKRHSGSYLVTSV
NT seq 8628 nt   +upstreamnt  +downstreamnt
atgtacgcctccctcggctcgggtccggtcgccgcgttgcctgcttcggtaccaccctgt
cctctcgggtcctggagctccggcggcggcaggggctgtgtccagcaggagaggaagcgc
cggggctgcgtccgttcttctgtccgcggggcgaacgtctggcaggaagtacttaaacaa
ctacaaggaagtattgaagatgaagctatggcttcgtctggacagattgatttattagag
cgtctcaaagaacttaacttagatagcagtaatttccctggagtgaaactacggtcaaaa
atgtccctccgttcttacggaagccgagaaggatctgtatctagtcgttcaggagagtgc
agtcctgttccaatgggttcatttccgagaagagggtttgtaaatggaagcagagaaaat
accggttatttagaagaacttgaaaaagagagatcattgcttcttgctgaccttgacaaa
gaagaaaaggaaaaagactggtattacgctcaacttcagaatctcactaaaagaatagat
agtcttcctttaactgaaaatttttccttacagacagatatgaccagaaggcaattggaa
tatgaagcaaggcaaatcagagttgcaatggaagaacaactgggtacttgccaggatatg
gaaaaacgagcacagcgaagaataaccagaattcaacaaatagagaaggacatacttcgt
atacgacagcttttacagtcccaagcaacagaagcagagaggtcatctcagagcaagcat
gaagccagctcacatgaagctgagcgacagaatgaaagtcaaggagtggcagaaatcaac
atggcaacttcgggtagtggtcagggttcaactgcacgaatagatcatgaaacagccagt
gttttgagttctagcagcacacattctgctcctcgaaggctgacaagtcatctgggaacc
aaggtggaaatggtgtattcattgttgtcaatgcttggtactcatgataaggatgatatg
tcgcgaactttgctagctatgtctagctcccaggacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaagactctgtgttgttg
ggaaattcccggggcagtaaagaggctcgggccagggccagtgcagcactccacaacatc
attcactcacagcctgatgacaagagaggcaggcgtgaaatccgagtccttcatcttttg
gaacagatacgagcttactgtgaaacctgttgggagtggcaggaagcccatgaacaaggc
atggaccaggacaaaaatccaatgccagctcctgttgaacatcaaatctgtcctgctgtg
tgtgttctaatgaaactttcgtttgatgaggagcatagacacgcaatgaatgaacttggt
aggaaggctacccggggcatttcatcacaggagctagggcaggggctttcagggggacta
caggccattgcagaattattgcaagtggactgtgaaatgtatggacttactaatgaccac
tacagtattaccttaagacgatatgcaggaatggctttgacaaacttgactttcggagat
gtagccaacaaggctacactatgctctatgaaaggctgcatgagagcacttgtggcccaa
ctaaaatctgaaagtgaggacttacagcaggttattgcaagtgttttgaggaatctgtct
tggagagcagatgtaaatagtaaaaagactttgcgtgaagttggaagtgtgaaagcattg
atggaatgtgctttagaagtgaaaaaggaatcaaccctgaaaagcgtactgagtgcctta
tggaatttgtcagcacactgcactgagaataaagctgatatatgtgccgtagatggtgcg
cttgcatttttggttggcactctcacttaccggagccagacaaatactttagctattatt
gaaagtggaggtgggatattacggaatgtgtccagcttgatagctacgaatgaggaccac
aggcaaatcctaagagagaataattgcttacaaaccttattacaacacttgaaatctcac
agtttgacaatagtcagtaatgcatgcggaaccttgtggaatctctcagcaagaaatcct
aaagatcaggaagcattatgggacatgggagcagtcagcatgctcaagaacctcattcat
tcaaagcacaagatgattgctatgggaagtgctgcagctttaaggaatctcatggcaaat
agacctgcaaagtataaggatgccaatatcatgtctcctggttcaagcttgccttctctt
catgtcaggaaacaaaaagccctagaagcagaattagatgctcagcatttatcagaaact
tttgacaatattgacaatttaagtcccaaggcatctcatcgtagtaagcagagacacaag
caaaatctctatggtgactatgtttttgacaccaatcgacatgatgataataggtcagac
aattttaatactggaaacatgactgtcctgtcaccatatttaaatactacagtgttgccc
agctcctcttcatcaaggggaagtgtagatagttctcgttctgagaaagatagaagtttg
gagagagaacgaggtattagcctagtcaactaccacccagcaacagaaaatccaggaacc
tcttcgaagcgaggtttgcagatttctaccactgcagcccagattgccaaagtcatggaa
gaagtatcagccattcatacctcccaggaagacagaagttctgggtctaccccggaacta
cattgtgggacagatgagaggaatgcactaagaagaagctctaccgcccacacacatgca
aactcttacaacttcaccaagtcagaaaactcaaacaggacatgtccagtgccatatgcc
aaagtagaatacaagagatcttcaaatgatagtttaaatagtgtcagcagtagtgatggt
tatggtaaaagaggtcaaatgaaaccttcagttgaatcctattctgaagatgaggaaagt
aaattttgcagctatggtcagtatccagctgacctagcccataaaatacatagtgcaaat
catatggatgataatgatggagaactagatacaccaataaattatagtcttaaatattct
gatgaacagttgaactccggaaggcaaagtccttcacagaatgaaagatgggcaagaccc
aaacatataatagaggatgaaataaaacaaaatgagcaaagacaatcaaggagtcaaagc
acaacttatcctgtatatcctgagagcactgatgataaacacctcaagttccaaccacat
tttggacagcaagaatgtgtttccccatataggtcaagagcagccaatggttcagaaaca
aatcgagtaggttctaatcatggaattaatcaaaatgtaaatcagtctttgtgtcaggaa
gatgactatgaagatgataagccaacaaactatagtgaacgttactctgaggaagagcaa
catgaggaggaagagagaccaaccaattatagcataaaatataatgaagaaaaacatcat
gtggatcagcctattgattatagtttaaaatataccacagacattccttcttcacagaaa
ccagcgttttcattctcaaagaattcatctggacaaagcactaaaactgaacacatctct
tcaagcagtgagaatacatccacaccttcatctaatgccaagaggcagaatcagctccat
ccaagttcagcacagagcaggagtggtcaggcccaaaaagccacctcttcctcttgcaaa
gttccctctatcaaccaagaaacaatacagacttactgtgtagaagataccccaatatgt
ttttcaagatgtagttcattatcatctttgtcatcagctgaagatgaaatagggtgtgat
cagacaacacaagaagcagattctgctaataccctacaaatagcagaaataaaagaaaac
agcggaactagatcaactgaagattctgtgagtgaagttccaacagtgtcacagcacatt
agaaccaaatccagcagactccaggcttctggtttatcttcagaatcagccaggcacaaa
gctgttgaattttcttcaggggccaaatctccatcaaagagtggtgctcagacacctaaa
agtccaccagagcactacgttcaggagaccccactcatgtttagcagatgtacttctgtc
agctcacttgatagttttgagagtcgttcgattgccagctccgttcagagtgaaccctgc
agtggaatggtgagtggcattataagccccagtgaccttccagatagccctggacaaacc
atgccaccaagcagaagtaaaacccctcctccccctcctcctcaaacagctcagactaag
caagaagtacctaaaaataaagcacctagtgctgagaagagagaaagtggccctaagcaa
gctgctgtaaatgctgcagtacagagggtccaggttcttccagatgctgatgctttgtta
cattttgccacagaaagtactcctgatggattttcttgttcatctagcctgagtgctctg
agcctcgatgagccatttattcagaaagatgtggagctaagaataatgcctccagttcag
gaaaatgacaatgggaatgaaacagaaaatgagcagcctgaagaatcaaatgaaaaccag
ggaaaagaggcagaaaaacccactgattctgaaaaagatctattagatgattcagatgat
gatgatattgaaatactagaagagtgtattatttctgccatgccaacaaaatcttcacgc
aaagccaaaaagccagcccagacttcttccaaattacctccacctgtggcaaggaaacca
agtcaactgcctgtgtacaaacttctgccatcacaaaacagattacaagcacaaaagcat
gttagttttacaccaggagatgatatgcctcgagtgtattgtgtagaagggacacctata
aacttttccacagctacatctctaagtgatctaacgatagaatcccctccaaatgagtta
gctgctggagaaggtgttagagcaggaacacagtcaggtgaatttgaaaaacgagacacc
attcctacagaaggcagaagtacagatgaggctcaaacagggaaagcctcatctgtaact
atacctgaactggatgacagtaaaacagaagaaggcgatattcttgcagaatgcattaat
tctgctatgcccaaaggaaaaagtcacaagcctttccgtgtgaaaaagataatggaccag
gtccaacaagcatctatgtcttcatctggaactaacaaaaatcaattagatggtaagaaa
aagaaacctacttcaccagtaaagcctataccacaaaacactgaatacaggacacgtgta
agaaaaaatacagactcaaaaaataatttaaatgctgaaagaaatttctcagacaacaaa
gattcaaagaaacagaacttgaaaaataactccaaggacttcaatgataaggtcccaaat
aatgaagatcgagtcagaggaagttttacttttgattcacctcatcattacacacctatt
gaaggcactccatactgtttttcacgaaatgattctttgagttctctagattttgatgat
gatgatgtcgacctttccagggaaaaggctgaactaagaaaggggaaggaaaataaggaa
tcagaagctaaagttaccaaccacacagaactaacctcaaaccaacaatcagctaataag
acacaagctgttccaaaacatccaataaatcgaggtcagcctaaacccgtgctgcagaag
caatccacttttccccagtcctccaaagatataccagacagaggggcagcaacagatgag
aaattacagaattttgctattgaaaatactccggtttgcttttcccgaaattcctctcta
agttctcttagtgacattgatcaagaaaacaacaacaacaaggaaaatgaacctatcaaa
gagacagagccccctgactcacagggagaaccaagtaaacctcaggcatcaggttatgct
cctaaatcatttcacgttgaagatacccctgtttgtttctcaagaaacagttctctcagt
tctctcagtattgattctgaagatgacctgttgcaggaatgtataagttctgcaatgcca
aaaaagaaaaagccttcaagactcaaggctgataatgaaaagcatagtcccagaaatatg
ggtggcatattagtagaagatttgacactcgatttgaaagatatacagagaccagattca
gaacatggtttatcccctgattcagaaaatttcgattggaaagctatccaggaaggtgca
aattccatagtaagtagtttacatcaagctgctgccgctgcatgtttatctagacaagct
tcgtctgattcagattccatcctttccctgaaatcaggaatctctctgggatcaccattt
catcttacacctgatcaagaggaaaaaccctttgcaagtaataaaggcccacgaattcta
aaacctggggagaaaagcacattggaaactaagaagttagaatctgaaaataaaggaata
aaaggagggaaaaaagtttataagagtttgattactggaaaagttcgatctaattcggaa
gtttcaagccaaatgaaacaaccccttcaagcaaacatgccttcactctctcgaggtagg
acaatgattcatattccaggagttcggaatagctcttcaagtacaagtccggtatctaaa
aaaggcccaccccttaagactccagcctccaaaagccctagtgaaggtcaggcagccacc
acttcccccagaggagccaagccatcagtgaagtcagaattaagccccgttacgaggcag
gcatcccagacacctgggtcaaataaagggccttctagatcaggatctagagattccact
ccttcaagacctgcccagcagccattaagtagacctatgcagtctccagggcgaaactca
atttctcctggtagaaatggaataagtcctcctaacaaattatctcaactgccaaggacg
tcatcccctagtactgcttcaactaagtcctcgggttctgggaaaatgtcttacacatct
cctggcagacagatgagccaacagaacctcaccaaacaaacaggtttttccaagaatgtc
agtagtatcccaagaagtgaatctgcctccaaaggactaaatcaaatgagtactagcaat
ggatccaataaaaaggtagaactttctagaatgtcttcaactaaatcaagtggaagtgaa
tctgataggtcagagagacctgtattagtacgccagtcaactttcatcaaagaagctcca
agcccaaccctaaggagaaaattggaggaatctgcttcatttgaatctctttctccatct
tctagaccagattctcccactaggtcccaggcacagactccaattttaagtccttccctt
cctgatatgtctctgtctacacattcgtctgttcaggctggtggatggcgaaaactccca
cctaatctcagtcccaccatagagtataatgatggaagaccagtaaagcgccatgatata
gcacgctctcattctgaaagtccttccagacttcccatcaataggtcaggaacctggaaa
cgtgagcacagcaaacactcatcatcccttcctcgagtaagcacttggaggagaactgga
agttcatcctcaattctttctgcttcatcagaatctagtgaaaaagcaaaaagtgaggat
gaaaaacatgtgaactctacttcaggatccaaacaaactaaagaaaaccaagtatccaca
aaaggtacatggagaaaaatgaaagaaagtgaaatttctcccaccaatagtacttctcag
accacttcctcaggtgctgcaaatggtgctgaatcaaagactctgatttatcaaatggca
cctgctgtttctaaaacagaggatgtttgggtgagaattgaggactgtcccattaacaac
cctagatctggaagatctccaacaggaaatactcccccagtgattgacactgttacagaa
aagggaaacccaaacactaaagattcaaaagataatcagggaaaacaaaatgtgagcaat
ggtagtgctcctgtacgcaccatgggtttggaaaaccgcctgaactcctttattcaggta
gatgccccagaccaaaaaggaactgaggcaaaaccgggacaaagtaatcctgtccctgca
tcagaggctaatgaaagttctatagctgaacgtaccccatttagttctagcagctcaagc
aagcacagttcaccgagtgggactgttgctgccagagtgagtccttttaattacaaccca
agcccaaggaaaagcagcgcagatagcacttcagcccgaccatctcagatcccaacgcca
gtgaataacaacacaaagaaacgagattcaaaaactgacaataccgaatccagtggaact
caaagtcctaaacgccattctgggtcttaccttgtgacatctgtttaa

KEGG   Physeter catodon (sperm whale): 102990003
Entry
102990003         CDS       T06011                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04810  Regulation of actin cytoskeleton
pcad04934  Cushing syndrome
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05217  Basal cell carcinoma
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102990003 (APC2)
   04390 Hippo signaling pathway
    102990003 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102990003 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102990003 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990003 (APC2)
   05206 MicroRNAs in cancer
    102990003 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990003 (APC2)
   05225 Hepatocellular carcinoma
    102990003 (APC2)
   05226 Gastric cancer
    102990003 (APC2)
   05217 Basal cell carcinoma
    102990003 (APC2)
   05213 Endometrial cancer
    102990003 (APC2)
   05224 Breast cancer
    102990003 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102990003 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    102990003 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102990003 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102990003 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102990003 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102990003 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102990003 (APC2)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102990003 (APC2)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102990003 (APC2)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     102990003 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Suppressor_APC Arm SAMP bZIP_1 Sec2p IL4 HALZ
Other DBs
NCBI-GeneID: 102990003
NCBI-ProteinID: XP_028340465
UniProt: A0A455AUY9
LinkDB
Position
Unknown
AA seq 2237 aa
MTSSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPALVPEPTAGTPEGSPVHSSGPSKDSF
GELSRATIQLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETFSMQMD
LIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLSAQDRVQQTEPQAL
LAVKSMPMDEDPEAEVPTHPEDGAPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSSS
PESCVAMRRSGCLPLLLQILHGTEAGAGGRNGTPGAPGAKDARMRANAALHNIVFSQPDQ
GLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGGGAGGAPVPIEPQICQATCAVMKL
SFDEEYRRAMNELGGLQAVAELLQVDYEMHEMTRDPLNLALRRYAGMTLTNLTFGDVANK
AALCARRGCMEAIVAQLASDSEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMQCV
LRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESGG
GILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSAGDQE
LLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQAAATAVSPGACAPSLYVR
KQRALEAALDARHLAQALDHLEKQGLPEAEAASKKPLPPLRHLDGLAQDYASDSGCFDDD
DAPSLATAAAATAEPTSPAVLPLFLGSPFLQGQALARTPPTRRGGLESEKEAGGEAAVAA
RAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAHSCSPCRGPEAG
RREAGGRAHPLLRLKAAHASLSNDSLNSGSISDGHCPREHSRPCLLAALAEHCEGPLCGQ
ARPSRLDLNLPGGQVEPKARDAVATDARVCTIKLSPTYQRVPLLEGTARAGAGSLAPRAR
KQAWLPAEDLSKVPEKLAAEKAPLCLSRCSSLSSLSSAGRPGPSEAGDLGDSDSSLEGLE
EAGLDGAWQGPGAASLPMAIPVPRRGRGPGAEDATPSSSSENCVQETPLVLSRCSSVSSL
GSFESPSIASSVASDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPPAPAPPGEREVTQ
FSLQWESYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHELYV
QKDVELRLLPPACPERSSGGGVGPGHRRRDEAGGRLEGPTSTDRDLELLRECLGGAVPAR
LRKVASALVPGHRTLPVPVYMLVPAPTREDESCTDSAEGTPVTFSSATSLSEETLQGPPR
DGGPAQGQKAAGRAAPTRQPAGHRHRAGGTGRSTEQPRGAGRSRARLELPLCRPPSACRD
RDSSRPGQARGDGALQSLCLTTPTEEAVYCFYGNDSDEEPSAAAAVAPPRRASAIPRAVK
RESPAGGRKEVQAVPKVVPPKVAAPKVAPPDRAQPSLIADETPPCYSLSSSASSLSEPEP
FERAASRPRACEPGVTKDPGPGGRRDGAPRPRAEAELLRRCTGSAVPRRRPQVSGPGCHQ
SRAVQQKRPAGGPREHSEEAPGSDHASDLDSVEWRAIQEGANSIVTWLHQAAAEATREAS
SESDSVLSFASGQSVGSTLQPPLQRKGRRPRAEGQAGSAMRPEKQDRALAQRRGGLEKPR
GHQKAASGVPAVLRGRTVIYMPSPATRAQPKGAPGPRNVPRKTGAPSPVQPTAPAKTPGP
GQQRSRSLHRPGKISELAALSPPQRSATPPARLAKTPSSSSSQTSPASQPLPRRSPPAAQ
AAGPLPGPGASPTTKTPARALLAKQHKTQKSPVRIPFMQRPTRRGPPPLARATPEPGPRA
RGGRPGLVRVASARSSGSEASDRSGFRRQLTFIKESPGLLRRRRTELSDAEAATPATQAG
LPRRGRPTLPAVFLCSSRCDELRAAPRQAPAPQRPATARPGLGERPPRRTSSESPSRLPV
RTPAARPETVKRYASLPHISVARGPNAPAPGPVADNAPRSSTGEAAPGTTWRRIRDEDVP
HILRSTLPPRALPLLGSSPEDGPTGPPQRKTSDAVVQTEDFAAAKTNSSTSPSLESWATP
QATTGGPPSLLLGSDVDGPGPAKAPAPGPFVPASRHGSPSRSARVPPFNYVPSPMVAATT
DSAVEKAPAPVLTGLLG
NT seq 6714 nt   +upstreamnt  +downstreamnt
atgacgagctccgtggcgccctacgagcagctggtgcggcaggtggaggccttgaaggcc
gagaacagtcacctgaggcaggagcttcgggataactcaagccacttgtccaagctggag
acagaaacatcgggcatgaaggaggtgctgaagcacttgcagggaaagctggagcaggag
gcccgcgtgctggtgtcctcggggcagactgaggtgctggagcagctgaaagccctgcag
atggacatcaccagcctgtacaacctcaagttccagcccccggctctggtccccgagccc
actgccgggacccccgagggaagcccggtgcacagctctgggccctccaaggacagcttt
ggggagctgagccgggccaccatccagctgctggaggaactggaccgggaacggtgtttc
ctgttgaatgagattgagaaggaggagaaggagaagctctggtattactcgcagctgcag
ggcctatccaagcgcctggacgaactcccgcacgtggagacgttctcgatgcagatggat
ctgatccggcagcagctggagttcgaagcccagcacatccgctcgctgatggaggagcgc
ttcggcacctcggacgagatggtgcagcgggcgcagatccgtgcttcccgcctggagcag
atcgacaaggaattgctgtcggcgcaggaccgggtgcagcagaccgagccccaggccttg
ctggcagtgaagtcgatgccgatggacgaggaccccgaggctgaggtccccacgcaccct
gaggatggagcccctcagccgggcaacagcaaggtggaggtggtcttctggctgctgtcc
atgctggcgacgcgtgaccaggaggacacggcacggacgctgctcgccatgtccagctca
cctgagagctgcgtggccatgcgccgctcgggctgcctgccgctgctgctgcagatcctg
cacggcaccgaggccggggctgggggtcgcaacgggaccccaggggcgccgggagccaag
gatgcgcgcatgcgcgccaacgcagcactgcacaacatcgtcttctcccagccggaccag
ggtctggcgcgcaaggaaatgcgcgtcctgcacgtgctcgagcagatccgtgcctactgt
gagacctgctgggactggctgcaggcccgggatggcgggcccgagggcggcggcgccggc
ggcgccccggtccccatcgagccacagatctgccaggccacctgcgccgtgatgaagctg
tccttcgacgaggaataccgccgcgccatgaacgagctgggtgggctgcaggccgtggcg
gagttactgcaggtcgactatgagatgcacgagatgacccgggaccctctcaacctggcc
ctgcgccgatacgccggcatgaccctcaccaacctaaccttcggggacgttgccaacaag
gccgcactgtgtgcccgccggggctgcatggaggccatcgtggcccagctggcgtccgac
agcgaggaactgcaccaggtggtgtccagcatcttgcgcaacctgtcctggagggcggac
atcaacagcaagaaggtgctgagggaggtgggcagcatgacggccctgatgcagtgcgtc
ctgcgagcctccaaggagtccaccctgaagagcgtgctcagcgccctgtggaacctctca
gcgcacagcacggagaacaaggccgccatctgccaggtggacggcgccctgggcttcctg
gtcagcacactgacctacaagtgccagagcaactcgctggccatcatcgagagcggaggc
ggcatcctgcgcaacgtgtccagcctcatcgccacccgtgaggactacaggcaggtgctg
cgggaccacaactgcctgcagacgctgctgcagcacctgacgtcgcacagcctgaccatc
gtgagcaacgcgtgcggcacgctctggaacctgtcggcccgcagtgccggcgaccaggag
ctgctgtgggacctgggcgccgtgggcatgctgcgcaacctggtgcactccaagcacaag
atgatcgccatgggcagtgccgccgccctgcgcaacctgctggcccaccggcctgccaag
taccaggcggcagcaaccgccgtctcgcccggcgcctgtgcgcccagcctgtacgtgcgc
aagcagcgggcgctggaggctgcgctggacgcgcggcacctggcgcaggcgctcgaccac
ctggagaagcagggcctgcccgaggccgaggccgcctccaagaagccgctgccgcccctg
cgccacctggacggcctggcccaggactacgcttccgactcgggctgcttcgatgatgac
gacgcaccctccctggccaccgctgctgccgccaccgccgagcccaccagccccgccgtg
ctgcccctcttcctgggcagccccttcctgcagggccaggcgctggcccgcaccccgccc
acccgccggggcggcctggagtccgagaaggaggccggcggggaggcagctgtggcagcc
agggccaaggccaagctggcactggcagtggcgcgcatcgaccggctggtggaggacatc
tcggccctgcacacctcgtccgacgacagcttcagcctcagctccggggatcctgggcag
gaggccccgcgggagggccgcgcgcactcctgctccccttgccgggggcccgaggcgggg
cggcgagaggccggcggccgggctcacccgctgctgcggctcaaggcggcccacgccagc
ctctccaatgacagtcttaacagcggcagcatcagcgacgggcactgtccccgcgagcac
tcgcggccctgcctgctggccgcgctggccgagcattgcgagggacccctgtgcggccag
gcgcggcccagccggcttgacctcaacctgcccggcggccaggtagagcccaaggcccgg
gacgccgtggccacagatgcccgcgtgtgcaccatcaagctgtcgcccacctaccagcgt
gtgccgctgcttgagggcactgccagagcaggcgcagggtccctggcccccagggcccgg
aaacaggcctggctgcccgcagaggacctgagcaaggtgcccgagaagctggcggcagag
aaggcgcccctctgcctgtcccgctgcagctccctgtcctcactgtcttccgccggccgc
ccagggcccagtgaggctggggacctgggcgacagcgactcgtccctggaggggctggag
gaggccgggctggacggggcctggcagggcccgggggccgcctccctgcccatggccatc
ccggtgcctcggaggggccggggcccgggggcggaggatgccacaccgtccagctcgtcc
gagaactgcgtgcaggagacgccgctggtgctgagccgctgcagctcggtcagctcgctg
ggcagcttcgagagcccatccatcgccagctcggtcgccagcgacccgtgcagcgggctg
ggcagcggtacagtcagccccagcgagctgcccgacagcccggggcagaccatgccaccg
agccgcagcaagacgcccccgccggcccccgcaccgccgggcgagcgtgaggtcacccag
ttcagcctgcagtgggagagctacgtgaagcgcttcctggacatcgccgactgccgggag
cgctgccggctgccgtccgagctggacgcgggcagcgtgcgcttcaccgtggagaagccc
gacgagaacttctcgtgtgcttccagcctgagcgcgctggccctgcacgagctctacgtg
cagaaggacgtggagctgcggctgctgcccccggcctgccccgagcgcagcagtggggga
ggcgtgggccccgggcaccgccggcgggatgaagccggcggccgcctcgaagggcccaca
tccaccgaccgggacctggagctgctgcgcgagtgcctgggtggggccgtgcccgcccgg
ctccgcaaggtggcctcggcgctggtgcctggccaccgcaccctgcccgtgcccgtctat
atgctggtgcccgccccgacacgggaggatgagtcctgcaccgactcggccgagggcacg
ccggtcaccttctccagcgccacctccctcagtgaggagacgctgcagggaccccccagg
gacggcgggcctgcgcaggggcagaaggctgcgggccgtgccgcacccaccaggcagccc
gccgggcaccggcacagggcggggggcacgggccggagcacagagcagccccggggggct
ggcaggagccgcgcaaggctggagctgcccctctgccggcccccgagcgcctgcagggac
agggacagctcccgcccgggccaggcacgtggggacggggccctgcagtctctgtgcctc
acgacgcccaccgaggaggccgtgtactgcttctacggcaacgactcagacgaggagccg
tccgcagcagcggcggtggcacccccgcggcgggcatctgcgatcccccgcgcggtgaag
agggagtccccggctggtggcaggaaggaggtgcaggccgtgcccaaggtcgtgccgccc
aaggttgctgcgcctaaggtcgcgccgccggaccgggcccagcccagcctcatcgccgat
gagacaccaccatgctactccctgagctcctccgccagctccctgagcgagcctgagccc
tttgagcgcgcagccagccggccccgagcctgtgagccaggggtcaccaaggacccaggc
cccggaggcaggcgcgacggcgccccacgcccgcgggccgaggcagagctgctccggcgc
tgcactggctcagccgtgcccaggcgccggccccaggtgtctggcccagggtgccaccag
tccagagcggtgcagcagaagaggccagcaggggggccccgggagcacagcgaggaggcg
ccgggctcggaccacgcctcagacctggacagcgtcgagtggcgcgccatccaggagggg
gccaactccatcgtcacgtggctacaccaggcagcggcggaggccacccgcgaggcctcc
tctgagtctgactccgtcctgtcctttgcctcggggcagtcggtgggctccaccctgcag
cctcccctgcagaggaaggggcgacggccaagggcagagggccaagcaggcagtgccatg
cggccagagaaacaggacagggctctggcccagcgcagaggcggcctggagaagccacgt
ggccatcagaaggccgcgtccggggtgccagccgtgctccggggacggacggtgatctac
atgcccagcccagccacccgggcccaacccaaaggtgcccctgggccccgcaacgtgccg
agaaagacgggagccccaagcccagtgcagccaacagcccccgccaaaacccccggcccc
gggcagcagcggtctcgaagcctgcaccgacctggcaagatctcggagctggcggcgctg
agcccccctcagaggagtgccacgccacccgcccgcctcgccaagaccccctcgtcgagc
tcctcccagacctccccggcctcccagcctctgccgaggaggtcacccccagccgcccag
gctgcaggacccctgcccggccccggggcctcccccacaaccaagactcccgcccgggcc
ctgctggccaagcagcacaagacacagaagtcgcccgtgcggatccccttcatgcagagg
cccaccaggcgggggccgccacccctggccagggccaccccggagccaggtccaagggcc
cgagggggccgcccagggctggtgcgtgtggcctccgcccgctccagcggcagcgaggcc
tccgaccgctccggtttccggcggcagctgaccttcatcaaggagtcgccgggcctgctg
cgccgccgacgcaccgaactgtccgacgccgaggccgccaccccggctacccaggccggc
ctgccccgccgtggccggcccacgctacccgccgtcttcctatgctcctcgcgctgtgat
gagctgcgggcggccccccggcaggctccggccccccagcggcccgccacggcccggccc
ggcctgggagagcggccgccccggcgcaccagctctgagagcccgtctcgcctgcccgtc
cgcacgccggccgcccggcccgagacggtcaagcgctacgcctccctgcctcacatcagc
gtggcccgcgggcccaacgcccccgcccctgggcctgtggcggacaacgcgccccgcagc
agcaccggggaggccgcgccaggcaccacgtggcgtcgcatccgggacgaggacgtcccg
cacatcctgcggagcacgctgcccccccgcgccctgcccctgctgggctcctcacccgag
gacggccccacaggtcctccgcagcgcaagaccagcgacgccgtggtccagaccgaggac
ttcgcggctgccaagaccaactcgagcacgtccccgagcctggagagctgggcgacccca
caggccacgaccggcggccccccctccctcctcctcggcagcgacgtggacgggccgggc
cccgccaaggcgcccgctcccggccccttcgtccccgccagccgacacggctcccccagc
cgctccgcccgcgtcccccccttcaactacgtgcccagccccatggtggcagccaccact
gactctgccgtggagaaagcccccgcccccgtccttaccggcctcctgggatag

DBGET integrated database retrieval system