KEGG   Physeter catodon (sperm whale): 102974344
Entry
102974344         CDS       T06011                                 

Gene name
ARHGEF6
Definition
(RefSeq) rho guanine nucleotide exchange factor 6 isoform X1
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04810  Regulation of actin cytoskeleton
pcad05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102974344 (ARHGEF6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102974344 (ARHGEF6)
Membrane trafficking [BR:pcad04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102974344 (ARHGEF6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF CH RhoGEF67_u1 SH3_2 SH3_9 SH3_1 PH CAMSAP_CH ZapB Nsp1_C
Other DBs
NCBI-GeneID: 102974344
NCBI-ProteinID: XP_023983943
UniProt: A0A2Y9T0N6
LinkDB
Position
21
AA seq 776 aa
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLRPGSIEKYCLEP
QTEADCTNNINDFLKGCAALQVEVFDPDDLHAGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAANSSQTNPQGAVSSTAPGLQRQSKPVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETTPLTKN
YYTVVLQNILDTEKDYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVITQHSDDLERFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQD
VRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQYGTCEEKEERYLMLFSSVLIM
LSASPRMSGFIYQGKIPIAGMVVTRLDEIEGNDYTFEITGNIVERIVVHCGNNQDFQDWL
EHLYRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKERMSYILKESGKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQIL
KVIEAYCTSANFQQGHGSSARKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYA
LKDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECMRAESSSKTSILP
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgaatccagaagaacgcatcgtgacatggcttatatctttgggagtattagattccccc
aaaaagaccatctgtgatccggaggagttcttgaagtcctcgctgaaaaatggggtagtg
ctatgcaaactgatcaacagacttaggcctggctctatagaaaagtactgtctggagccc
caaactgaagctgactgcaccaacaacatcaatgacttcctgaaaggatgtgcagccctt
caagtggaggtatttgatcctgatgaccttcatgcaggggtcaatttctccaaggttctg
agcactcttttagctgtcaacaaagcaacagaagatcagctctcagaaaggccatgtgga
cgttcctcttctcttagcgctgctaatagttctcagacaaacccacagggagcagtttct
agcacagctccagggctgcaaaggcagtcaaagccagtggagatgacggaaaatggaagt
caccagttgatagtaaaggcgagattcaactttaagcagactaatgaagatgaactgtct
gtctgtaaaggggacatcatttatgtcactagagttgaagaaggaggctggtgggaaggc
acattaaatgggagaacaggctggttccctagtaattatgtccgagaaattaaatccagt
gagagacctctctcccccaaggctgtcaaaggatttgaaactactccacttaccaagaat
tattatactgtggtgttacagaatatcttggacactgaaaaagattatgctaaagaactt
cagtctcttcttgttacttacttaagacccctgcagtccaataacaatctgagtactgtg
gaatttacatctttattgggaaacttcgaggaagtatgcacgtttcaacagacgctctgc
caagccttggaagaatgttcaaagtttccagaaaaccaacacaaagtaggtggttgtcta
ctgaacctcatgcctcattttaaatctatgtatctggcttactgtgcaaatcatccttca
gctgtaaatgtaatcacccagcacagtgatgatctggaacgatttatggaaaatcaaggt
gcatctagcccaggtatcctcattttaacaacaagtctcagcaaacctttcatgcgactg
gaaaagtatgttactctcttgcaagagttggaacggcatatggaggatacgcatccagat
caccaggatattctgaaagcaatcatagcattcaaaactctcatggggcagtgccaagat
gtcagaaagagaaaacagctggagttgcagatactttcggaacctattcaggcatgggaa
ggggaggatattaaaaccttgggaaatgtgatctttatgtcgcaagtaatggtgcagtat
ggaacatgtgaggaaaaagaggagcggtacctcatgttattttcaagtgtcttgataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
atggtggtgactagattagatgaaattgaagggaatgactacacatttgaaatcactggt
aacatagtagagaggattgtggtccactgcggcaacaaccaggacttccaggattggctg
gagcatctgtacaggctgatcagaggacccgcctcttgcagttcgttatccaaaacatca
tcgtcctcctgtagtgctcattcctcttttagctctaccggacagccccgaggacccttg
gagcctcctcaaattataaaaccgtggagcttaagttgtctgcgacctgcgcctccactt
agaccatcagcagcgctaggttataaagagaggatgtcttatatcttaaaggaatctggt
aaaagccccaaaacgatgaagaagtttcttcacaaaagaaagaccgaaagaaagccctcg
gaggaggaatatgtcatccgcaaaagtacggctgctctggaagaggacgctcagattctg
aaagtgatcgaagcctactgtaccagtgccaactttcaacaaggccacggctcaagtgcc
cgcaaggattccgttccccaagtcttactccccgaggaagagaaactcatcattgaagaa
accagaagcaacggccagaccatcattgaagaaaagagccttgtcgatactgtttatgcc
ttgaaggatgaggtcaaagagctgaaacaggagaataaaagaatgaagcagtgcctggaa
gaagagttgaaatcaagaagggacctagaaaagctggtccggaggctgttgaagcaaact
gatgagtgtatgcgggccgagtccagtagcaagacctccattctcccgtaa

DBGET integrated database retrieval system