KEGG   Physeter catodon (sperm whale): 102976971
Entry
102976971         CDS       T06011                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04728  Dopaminergic synapse
pcad04910  Insulin signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04973  Carbohydrate digestion and absorption
pcad05010  Alzheimer disease
pcad05017  Spinocerebellar ataxia
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102976971 (AKT3)
   04012 ErbB signaling pathway
    102976971 (AKT3)
   04014 Ras signaling pathway
    102976971 (AKT3)
   04015 Rap1 signaling pathway
    102976971 (AKT3)
   04370 VEGF signaling pathway
    102976971 (AKT3)
   04371 Apelin signaling pathway
    102976971 (AKT3)
   04630 JAK-STAT signaling pathway
    102976971 (AKT3)
   04668 TNF signaling pathway
    102976971 (AKT3)
   04066 HIF-1 signaling pathway
    102976971 (AKT3)
   04068 FoxO signaling pathway
    102976971 (AKT3)
   04072 Phospholipase D signaling pathway
    102976971 (AKT3)
   04071 Sphingolipid signaling pathway
    102976971 (AKT3)
   04024 cAMP signaling pathway
    102976971 (AKT3)
   04022 cGMP-PKG signaling pathway
    102976971 (AKT3)
   04151 PI3K-Akt signaling pathway
    102976971 (AKT3)
   04152 AMPK signaling pathway
    102976971 (AKT3)
   04150 mTOR signaling pathway
    102976971 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102976971 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102976971 (AKT3)
   04218 Cellular senescence
    102976971 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102976971 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102976971 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102976971 (AKT3)
   04613 Neutrophil extracellular trap formation
    102976971 (AKT3)
   04620 Toll-like receptor signaling pathway
    102976971 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102976971 (AKT3)
   04660 T cell receptor signaling pathway
    102976971 (AKT3)
   04662 B cell receptor signaling pathway
    102976971 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102976971 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102976971 (AKT3)
   04062 Chemokine signaling pathway
    102976971 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102976971 (AKT3)
   04922 Glucagon signaling pathway
    102976971 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102976971 (AKT3)
   04920 Adipocytokine signaling pathway
    102976971 (AKT3)
   04929 GnRH secretion
    102976971 (AKT3)
   04915 Estrogen signaling pathway
    102976971 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102976971 (AKT3)
   04917 Prolactin signaling pathway
    102976971 (AKT3)
   04926 Relaxin signaling pathway
    102976971 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102976971 (AKT3)
   04919 Thyroid hormone signaling pathway
    102976971 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102976971 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102976971 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102976971 (AKT3)
   04728 Dopaminergic synapse
    102976971 (AKT3)
   04722 Neurotrophin signaling pathway
    102976971 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102976971 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102976971 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102976971 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102976971 (AKT3)
   05205 Proteoglycans in cancer
    102976971 (AKT3)
   05230 Central carbon metabolism in cancer
    102976971 (AKT3)
   05231 Choline metabolism in cancer
    102976971 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102976971 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102976971 (AKT3)
   05212 Pancreatic cancer
    102976971 (AKT3)
   05225 Hepatocellular carcinoma
    102976971 (AKT3)
   05226 Gastric cancer
    102976971 (AKT3)
   05214 Glioma
    102976971 (AKT3)
   05221 Acute myeloid leukemia
    102976971 (AKT3)
   05220 Chronic myeloid leukemia
    102976971 (AKT3)
   05218 Melanoma
    102976971 (AKT3)
   05211 Renal cell carcinoma
    102976971 (AKT3)
   05215 Prostate cancer
    102976971 (AKT3)
   05213 Endometrial cancer
    102976971 (AKT3)
   05224 Breast cancer
    102976971 (AKT3)
   05222 Small cell lung cancer
    102976971 (AKT3)
   05223 Non-small cell lung cancer
    102976971 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102976971 (AKT3)
   05017 Spinocerebellar ataxia
    102976971 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102976971 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102976971 (AKT3)
   04931 Insulin resistance
    102976971 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102976971 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102976971 (AKT3)
   05135 Yersinia infection
    102976971 (AKT3)
   05152 Tuberculosis
    102976971 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102976971 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102976971 (AKT3)
   05161 Hepatitis B
    102976971 (AKT3)
   05160 Hepatitis C
    102976971 (AKT3)
   05164 Influenza A
    102976971 (AKT3)
   05162 Measles
    102976971 (AKT3)
   05168 Herpes simplex virus 1 infection
    102976971 (AKT3)
   05163 Human cytomegalovirus infection
    102976971 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102976971 (AKT3)
   05169 Epstein-Barr virus infection
    102976971 (AKT3)
   05165 Human papillomavirus infection
    102976971 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102976971 (AKT3)
   05142 Chagas disease
    102976971 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102976971 (AKT3)
   01524 Platinum drug resistance
    102976971 (AKT3)
   01522 Endocrine resistance
    102976971 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102976971 (AKT3)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102976971 (AKT3)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102976971 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 102976971
NCBI-ProteinID: XP_023989391
UniProt: A0A2Y9TEP8
LinkDB
Position
4
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagtgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagacactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagacttcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctaccacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttagttcgagagaaagcaagtggaaaatactatgctatgaagattctgaaa
aaagaagttattattgccaaggatgaagtggcacacactttaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacgttctgtggtacaccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagccgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgcgggaggttacctttctacaaccaggatcatgagaaactttttgaactaattctaatg
gaagacattaaatttcctcgaacactttcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatactttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgatgaggacggtatggactgcatg
gacaatgagaggcggccgcacttccctcagttttcctactctgcaagcggacgagaataa

KEGG   Physeter catodon (sperm whale): 102981524
Entry
102981524         CDS       T06011                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04728  Dopaminergic synapse
pcad04910  Insulin signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04973  Carbohydrate digestion and absorption
pcad05010  Alzheimer disease
pcad05017  Spinocerebellar ataxia
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102981524 (AKT1)
   04012 ErbB signaling pathway
    102981524 (AKT1)
   04014 Ras signaling pathway
    102981524 (AKT1)
   04015 Rap1 signaling pathway
    102981524 (AKT1)
   04370 VEGF signaling pathway
    102981524 (AKT1)
   04371 Apelin signaling pathway
    102981524 (AKT1)
   04630 JAK-STAT signaling pathway
    102981524 (AKT1)
   04668 TNF signaling pathway
    102981524 (AKT1)
   04066 HIF-1 signaling pathway
    102981524 (AKT1)
   04068 FoxO signaling pathway
    102981524 (AKT1)
   04072 Phospholipase D signaling pathway
    102981524 (AKT1)
   04071 Sphingolipid signaling pathway
    102981524 (AKT1)
   04024 cAMP signaling pathway
    102981524 (AKT1)
   04022 cGMP-PKG signaling pathway
    102981524 (AKT1)
   04151 PI3K-Akt signaling pathway
    102981524 (AKT1)
   04152 AMPK signaling pathway
    102981524 (AKT1)
   04150 mTOR signaling pathway
    102981524 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102981524 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    102981524 (AKT1)
   04218 Cellular senescence
    102981524 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102981524 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102981524 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102981524 (AKT1)
   04613 Neutrophil extracellular trap formation
    102981524 (AKT1)
   04620 Toll-like receptor signaling pathway
    102981524 (AKT1)
   04625 C-type lectin receptor signaling pathway
    102981524 (AKT1)
   04660 T cell receptor signaling pathway
    102981524 (AKT1)
   04662 B cell receptor signaling pathway
    102981524 (AKT1)
   04664 Fc epsilon RI signaling pathway
    102981524 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    102981524 (AKT1)
   04062 Chemokine signaling pathway
    102981524 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102981524 (AKT1)
   04922 Glucagon signaling pathway
    102981524 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    102981524 (AKT1)
   04920 Adipocytokine signaling pathway
    102981524 (AKT1)
   04929 GnRH secretion
    102981524 (AKT1)
   04915 Estrogen signaling pathway
    102981524 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    102981524 (AKT1)
   04917 Prolactin signaling pathway
    102981524 (AKT1)
   04926 Relaxin signaling pathway
    102981524 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    102981524 (AKT1)
   04919 Thyroid hormone signaling pathway
    102981524 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102981524 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102981524 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    102981524 (AKT1)
   04728 Dopaminergic synapse
    102981524 (AKT1)
   04722 Neurotrophin signaling pathway
    102981524 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102981524 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    102981524 (AKT1)
   04213 Longevity regulating pathway - multiple species
    102981524 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102981524 (AKT1)
   05205 Proteoglycans in cancer
    102981524 (AKT1)
   05230 Central carbon metabolism in cancer
    102981524 (AKT1)
   05231 Choline metabolism in cancer
    102981524 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102981524 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102981524 (AKT1)
   05212 Pancreatic cancer
    102981524 (AKT1)
   05225 Hepatocellular carcinoma
    102981524 (AKT1)
   05226 Gastric cancer
    102981524 (AKT1)
   05214 Glioma
    102981524 (AKT1)
   05221 Acute myeloid leukemia
    102981524 (AKT1)
   05220 Chronic myeloid leukemia
    102981524 (AKT1)
   05218 Melanoma
    102981524 (AKT1)
   05211 Renal cell carcinoma
    102981524 (AKT1)
   05215 Prostate cancer
    102981524 (AKT1)
   05213 Endometrial cancer
    102981524 (AKT1)
   05224 Breast cancer
    102981524 (AKT1)
   05222 Small cell lung cancer
    102981524 (AKT1)
   05223 Non-small cell lung cancer
    102981524 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102981524 (AKT1)
   05017 Spinocerebellar ataxia
    102981524 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102981524 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102981524 (AKT1)
   04931 Insulin resistance
    102981524 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102981524 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102981524 (AKT1)
   05135 Yersinia infection
    102981524 (AKT1)
   05152 Tuberculosis
    102981524 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102981524 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    102981524 (AKT1)
   05161 Hepatitis B
    102981524 (AKT1)
   05160 Hepatitis C
    102981524 (AKT1)
   05164 Influenza A
    102981524 (AKT1)
   05162 Measles
    102981524 (AKT1)
   05168 Herpes simplex virus 1 infection
    102981524 (AKT1)
   05163 Human cytomegalovirus infection
    102981524 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102981524 (AKT1)
   05169 Epstein-Barr virus infection
    102981524 (AKT1)
   05165 Human papillomavirus infection
    102981524 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102981524 (AKT1)
   05142 Chagas disease
    102981524 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102981524 (AKT1)
   01524 Platinum drug resistance
    102981524 (AKT1)
   01522 Endocrine resistance
    102981524 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102981524 (AKT1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102981524 (AKT1)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102981524 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102981524
NCBI-ProteinID: XP_023986769
UniProt: A0A2Y9TF62
LinkDB
Position
11
AA seq 481 aa
MAVAGTSQRTSARILECEYIKTWRPRYFLLKNDGTFIGYKERPQDVERRESPLNNFSVAQ
CQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMD
FRSGSPGENSGAEEMEVALAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMK
ILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHL
SRERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG
IKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFE
LILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEK
KLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGADSERRPHFPQFSYSASGT
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcagtcgctggaacgtcacagaggacatctgctcggattcttgagtgtgagtacatc
aaaacctggcggccccggtacttcctcttgaagaacgacggcaccttcatcggctacaag
gagcggccgcaggacgtggagcggcgagagtcgcccctgaacaacttctctgtggcgcaa
tgccagctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcag
tggaccacggtcatcgagcgcacgttccatgtagagacccctgaagagcgggaggagtgg
acaactgccatccagacggtggccgacgggctcaagaggcaggaggaggagatgatggac
ttccggtcgggctcgcccggggagaactcaggggccgaggagatggaggtggcgctggcc
aagcccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggtaaaggc
accttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactacgccatgaag
atcctgaagaaggaggtcattgtggccaaggacgaggtggcccacacgctcacggagaac
cgcgtcctccagaactcccggcaccctttcctgacggccctgaagtactccttccagacc
cacgaccgcctgtgcttcgtcatggagtacgccaacgggggcgagctcttcttccacctg
tcccgggagcgggtgttccccgaggaccgggcccggttctacggcgccgagatcgtgtcc
gccctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaac
ctcatgctggacaaggacgggcacatcaagatcacggacttcgggctgtgcaaggagggc
atcaaggatggcgccaccatgaagaccttctgcgggacgcccgagtacctggcccccgag
gtgctggaggacaatgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgag
ctcatcctcatggaggagatccgcttcccacgtacgctcagccctgaggccaagtccctg
ctctcagggctgctcaagaaggaccccaagcagcggctcggtgggggctccgaggacgcc
aaggagatcatgcagcaccgcttcttcgccagcatcgtgtggcaggatgtgtatgagaag
aagctcagcccacccttcaagcctcaggtcacgtccgagacggacaccaggtattttgac
gaggagttcacagcccagatgatcaccatcacgccgcccgaccaagatgacagcatggag
ggcgcggacagcgagcggcggcctcacttcccgcagttctcctactcggccagcggcacg
gcctga

KEGG   Physeter catodon (sperm whale): 102990087
Entry
102990087         CDS       T06011                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04210  Apoptosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04611  Platelet activation
pcad04613  Neutrophil extracellular trap formation
pcad04620  Toll-like receptor signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04668  TNF signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04728  Dopaminergic synapse
pcad04910  Insulin signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04926  Relaxin signaling pathway
pcad04929  GnRH secretion
pcad04931  Insulin resistance
pcad04932  Non-alcoholic fatty liver disease
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad04935  Growth hormone synthesis, secretion and action
pcad04973  Carbohydrate digestion and absorption
pcad05010  Alzheimer disease
pcad05017  Spinocerebellar ataxia
pcad05132  Salmonella infection
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102990087
   04012 ErbB signaling pathway
    102990087
   04014 Ras signaling pathway
    102990087
   04015 Rap1 signaling pathway
    102990087
   04370 VEGF signaling pathway
    102990087
   04371 Apelin signaling pathway
    102990087
   04630 JAK-STAT signaling pathway
    102990087
   04668 TNF signaling pathway
    102990087
   04066 HIF-1 signaling pathway
    102990087
   04068 FoxO signaling pathway
    102990087
   04072 Phospholipase D signaling pathway
    102990087
   04071 Sphingolipid signaling pathway
    102990087
   04024 cAMP signaling pathway
    102990087
   04022 cGMP-PKG signaling pathway
    102990087
   04151 PI3K-Akt signaling pathway
    102990087
   04152 AMPK signaling pathway
    102990087
   04150 mTOR signaling pathway
    102990087
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102990087
  09143 Cell growth and death
   04210 Apoptosis
    102990087
   04218 Cellular senescence
    102990087
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102990087
   04550 Signaling pathways regulating pluripotency of stem cells
    102990087
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102990087
   04613 Neutrophil extracellular trap formation
    102990087
   04620 Toll-like receptor signaling pathway
    102990087
   04625 C-type lectin receptor signaling pathway
    102990087
   04660 T cell receptor signaling pathway
    102990087
   04662 B cell receptor signaling pathway
    102990087
   04664 Fc epsilon RI signaling pathway
    102990087
   04666 Fc gamma R-mediated phagocytosis
    102990087
   04062 Chemokine signaling pathway
    102990087
  09152 Endocrine system
   04910 Insulin signaling pathway
    102990087
   04922 Glucagon signaling pathway
    102990087
   04923 Regulation of lipolysis in adipocytes
    102990087
   04920 Adipocytokine signaling pathway
    102990087
   04929 GnRH secretion
    102990087
   04915 Estrogen signaling pathway
    102990087
   04914 Progesterone-mediated oocyte maturation
    102990087
   04917 Prolactin signaling pathway
    102990087
   04926 Relaxin signaling pathway
    102990087
   04935 Growth hormone synthesis, secretion and action
    102990087
   04919 Thyroid hormone signaling pathway
    102990087
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102990087
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102990087
  09156 Nervous system
   04725 Cholinergic synapse
    102990087
   04728 Dopaminergic synapse
    102990087
   04722 Neurotrophin signaling pathway
    102990087
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102990087
  09149 Aging
   04211 Longevity regulating pathway
    102990087
   04213 Longevity regulating pathway - multiple species
    102990087
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990087
   05205 Proteoglycans in cancer
    102990087
   05230 Central carbon metabolism in cancer
    102990087
   05231 Choline metabolism in cancer
    102990087
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102990087
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990087
   05212 Pancreatic cancer
    102990087
   05225 Hepatocellular carcinoma
    102990087
   05226 Gastric cancer
    102990087
   05214 Glioma
    102990087
   05221 Acute myeloid leukemia
    102990087
   05220 Chronic myeloid leukemia
    102990087
   05218 Melanoma
    102990087
   05211 Renal cell carcinoma
    102990087
   05215 Prostate cancer
    102990087
   05213 Endometrial cancer
    102990087
   05224 Breast cancer
    102990087
   05222 Small cell lung cancer
    102990087
   05223 Non-small cell lung cancer
    102990087
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102990087
   05017 Spinocerebellar ataxia
    102990087
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102990087
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102990087
   04931 Insulin resistance
    102990087
   04933 AGE-RAGE signaling pathway in diabetic complications
    102990087
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102990087
   05135 Yersinia infection
    102990087
   05152 Tuberculosis
    102990087
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102990087
   05170 Human immunodeficiency virus 1 infection
    102990087
   05161 Hepatitis B
    102990087
   05160 Hepatitis C
    102990087
   05164 Influenza A
    102990087
   05162 Measles
    102990087
   05168 Herpes simplex virus 1 infection
    102990087
   05163 Human cytomegalovirus infection
    102990087
   05167 Kaposi sarcoma-associated herpesvirus infection
    102990087
   05169 Epstein-Barr virus infection
    102990087
   05165 Human papillomavirus infection
    102990087
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102990087
   05142 Chagas disease
    102990087
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102990087
   01524 Platinum drug resistance
    102990087
   01522 Endocrine resistance
    102990087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102990087
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102990087
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102990087
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Seadorna_VP7
Other DBs
NCBI-GeneID: 102990087
NCBI-ProteinID: XP_028333694
UniProt: A0A455AEB7
LinkDB
Position
17
AA seq 390 aa
MSPHREEWMQAIQMVANSLKQRGPGEDPMDYKCGSPSDSSAAEEMEVAVSKARAKVTMND
FDYLKLLGKGTFGKVILVREKASGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPF
LTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDV
VYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAV
DWWGLGVVMYEMLCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQ
RLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITIT
PPDRYDSLGSLELDQRTHFPQFSYSASIRE
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtccccgcacagggaggagtggatgcaggccatccagatggttgccaacagcctcaag
cagcggggcccaggtgaggatcccatggactacaagtgtggctcccccagcgactcttct
gcagccgaggagatggaagtggcagttagcaaggcgcgggccaaggtgaccatgaatgac
ttcgactatctcaagctcctgggcaagggcacctttggcaaagtcatcctggtgcgggag
aaggccagtggccgctactacgccatgaagatcctgcggaaggaggttatcatcgctaag
gatgaagtcgcccacacggtcaccgagagccgggtcctccagaacaccaggcatccattc
ctcactgcgctgaagtacgccttccagacccacgaccgcctgtgcttcgtgatggagtac
gccaacggtggcgagctgttcttccacctgtcccgggagcgcgtcttcacggaggagcgg
gcccgcttttacggcgcggagatcgtctcagccctggagtacctgcactcgcgggacgtc
gtataccgtgacatcaagctggaaaacctcatgctggacaaagatggccacatcaagatc
actgacttcggcctgtgcaaagagggcatcagtgacggggccaccatgaaaaccttctgt
gggacccctgaatacctggcacccgaggtgctggaggacaacgactacggccgggcggtg
gactggtgggggctgggtgtggtcatgtacgagatgctgtgcggccgcctgcccttctac
aaccaggaccacgagcgcctcttcgagctcatcctcatggaggagatccgcttcccgcgc
acgctcagccccgaggccaagtccctgcttgctgggctgcttaagaaggaccccaagcag
aggctcggcggcgggcccagtgatgccaaggaggtcatggagcacaggttcttcctcagt
atcaactggcaggacgtggtacagaagaagctcctgccacccttcaaacctcaggtcacg
tctgaggttgacacaaggtactttgacgacgagttcaccgcccagtccatcacaatcaca
cccccggaccgctatgacagcctgggctcactcgaactggaccagcggacccacttccct
cagttctcctattcggccagcatccgagagtga

DBGET integrated database retrieval system