KEGG   Physeter catodon (sperm whale): 102977339
Entry
102977339         CDS       T06011                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102977339 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    102977339 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102977339 (YWHAQ)
   04114 Oocyte meiosis
    102977339 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102977339 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102977339 (YWHAQ)
   05160 Hepatitis C
    102977339 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102977339 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102977339 (YWHAQ)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102977339 (YWHAQ)
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102977339 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 102977339
NCBI-ProteinID: XP_007127714
UniProt: A0A2Y9FRC5
LinkDB
Position
12
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctttcggtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcatcgagcagaagaccgacacgtccgacaagaagctgcagctgattaaa
gactaccgggagaaagtggagtccgaactgcggtccatctgcaccaccgtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaag
atgaagggagattacttccggtaccttgctgaagttgcttgtggtgatgatcggaaacaa
acgatagataattcccaaggagcttaccaagaggcttttgatataagcaagaaagagatg
caacccacacacccaatccgcctgggtctggctcttaacttttctgtattttactatgag
atccttaataacccagaacttgcctgcacactggctaaaacggcttttgatgaggccatt
gcagaacttgatacactgaacgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacattatggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggcagagaactaa

KEGG   Physeter catodon (sperm whale): 102982286
Entry
102982286         CDS       T06011                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad05160  Hepatitis C
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102982286 (YWHAE)
   04151 PI3K-Akt signaling pathway
    102982286 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102982286 (YWHAE)
   04114 Oocyte meiosis
    102982286 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102982286 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102982286 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102982286 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102982286 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102982286 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102982286 (YWHAE)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102982286 (YWHAE)
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102982286 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 102982286
NCBI-ProteinID: XP_007123613
UniProt: A0A2Y9FI13
LinkDB
Position
14
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggatgtggagttgacagttgaa
gaaagaaacctcctatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacaggaaatgac
aggaaggaagctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacacatcccattcgcttaggtcttgctctcaatttttctgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacgcttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Physeter catodon (sperm whale): 102984255
Entry
102984255         CDS       T06011                                 

Gene name
YWHAB
Definition
(RefSeq) LOW QUALITY PROTEIN: 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102984255 (YWHAB)
   04151 PI3K-Akt signaling pathway
    102984255 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102984255 (YWHAB)
   04114 Oocyte meiosis
    102984255 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102984255 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102984255 (YWHAB)
   05160 Hepatitis C
    102984255 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102984255 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102984255 (YWHAB)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102984255 (YWHAB)
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102984255 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM
Other DBs
NCBI-GeneID: 102984255
NCBI-ProteinID: XP_023984114
UniProt: A0A2Y9T7M5
LinkDB
Position
14
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTEXNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaaactcgccgagcaggcggagcgc
tacgatgacatggctgcggctatgaaggcagtcacggagcaggggcacgagctctccaat
gaggagagaaacctgctgtctgttgcctacaagaatgtggtcggtgcccgtcgttcttcc
tggcgtgtcatctccagcatcgaacagaaaacagagnngaacgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatcgaggcagagctgcaggacatctgcaacgatgttctg
gagctgttggacaaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggcgattattttagatatctttctgaggtggcatctggagacaataaa
caaaccactgtgtcaaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgactgggcctggcacttaatttctccgtcttttac
tatgagattctaaactctcctgaaaaggcttgcagcctggcaaaaacggcatttgatgaa
gcgattgctgaattggacacactgaatgaagagtcttacaaagacagcaccctgatcatg
cagttgcttagggacaatctcactctgtggacgtcggaaaaccagggagacgaaggagat
gctggggagggagagaactaa

KEGG   Physeter catodon (sperm whale): 102986425
Entry
102986425         CDS       T06011                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma isoform X1
  KO
K16198  14-3-3 protein gamma/eta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad05160  Hepatitis C
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102986425 (YWHAG)
   04151 PI3K-Akt signaling pathway
    102986425 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102986425 (YWHAG)
   04114 Oocyte meiosis
    102986425 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102986425 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102986425 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102986425 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102986425 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102986425 (YWHAG)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102986425 (YWHAG)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102986425 (YWHAG)
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102986425 (YWHAG)
SSDB
Motif
Pfam: 14-3-3 DUF722 DUF3504 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Other DBs
NCBI-GeneID: 102986425
NCBI-ProteinID: XP_023976531
UniProt: A0A2Y9SCX5
LinkDB
Position
14
AA seq 247 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggcggagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtccaatgaa
gaaagaaacctcctctctgtggcctacaagaatgtagttggggcacgccgttcttcctgg
agggtcattagcagcattgagcagaagacatctgcagatggtaatgagaagaagatagag
atggtccgtgcttaccgtgaaaaaatagagaaggagttggaggccgtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagtgagacccagtatgagagcaaa
gtgttttacctgaagatgaaaggggactattaccgctacctggccgaagtcgccactgga
gagaagagggcgaccgtcgtggagtcatctgagaaggcctacagcgaagcccatgagatt
agcaaggagcacatgcagcccactcaccccattagattaggcctggcccttaactactcc
gttttctactatgagatccagaacgccccagagcaagcctgccacttggccaagaccgct
tttgatgacgccattgccgagctcgacactctcaacgaggactcctacaaggactccacg
ctcatcatgcagctcctccgcgacaacctcacgctctggacaagcgatcagcaagacgac
gacggtggagaaggcaacaattaa

KEGG   Physeter catodon (sperm whale): 102993808
Entry
102993808         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 14-3-3 protein zeta/delta-like
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102993808
   04151 PI3K-Akt signaling pathway
    102993808
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102993808
   04114 Oocyte meiosis
    102993808
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102993808
  09172 Infectious disease: viral
   05161 Hepatitis B
    102993808
   05160 Hepatitis C
    102993808
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102993808
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102993808
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102993808
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102993808
SSDB
Motif
Pfam: 14-3-3 FliM Peptidase_C98 FlaF CemA CSN7a_helixI
Other DBs
NCBI-GeneID: 102993808
NCBI-ProteinID: XP_023985092
UniProt: A0A2Y9T677
LinkDB
Position
6
AA seq 233 aa
MDKNKLVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VISNIEQKTEGAEKKQQMAQEYREKIETELRDICNDVLSLLEKFLILNASQAESKVFYLK
MKGDYYHYFAEDPAGDDKKGIVDQPQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYH
EILNSPEKAXSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDT
NT seq 702 nt   +upstreamnt  +downstreamnt
atggataaaaataagctggtgcagaaggccaaactggccgagcaggctgagcggtatgac
gacatggcggcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcatctcaaatattgagcaaaagacagaaggtgctgagaaaaaacagcagatggctcaa
gaatacagagagaaaattgagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatcctcaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccactatttcgctgaggaccctgctggtgatgacaagaaaggg
attgtggatcagccacagcaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
cagccaacacatcctatcagattgggtctggcccttaacttctctgtgttctattaccac
gagattctgaactcccctgagaaagcctgatctcttgcaaaaacagcatttgatgaagcc
attgctgaacttgatacattaagtgaagagtcatacaaagacagcacactaataatgcag
ttactgagagacaacttgacattgtggacatctgatacctaa

KEGG   Physeter catodon (sperm whale): 102995638
Entry
102995638         CDS       T06011                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad05160  Hepatitis C
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102995638 (YWHAH)
   04151 PI3K-Akt signaling pathway
    102995638 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102995638 (YWHAH)
   04114 Oocyte meiosis
    102995638 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102995638 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102995638 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102995638 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102995638 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102995638 (YWHAH)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102995638 (YWHAH)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102995638 (YWHAH)
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   102995638 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 102995638
NCBI-ProteinID: XP_028336115
UniProt: A0A455AHW5
LinkDB
Position
19
AA seq 220 aa
MLQVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYR
EKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSV
VEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIA
ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 663 nt   +upstreamnt  +downstreamnt
atgttgcaggtgaccgagctcaacgaacctctctccaatgaagaccgaaacctcctctcc
gtggcttacaagaatgtggttggtgcccggcggtcttcctggagggtcatcagcagcatc
gagcagaaaaccatggccgacgggaatgagaagaagctggagaaggttaaggcttaccgg
gagaagatcgaaaaggagctggaaacagtgtgcaatgacgtgctggccctgctggacaag
ttcctcatcaagaactgcaatgacttccagtatgagagcaaggtcttctacctgaagatg
aagggcgactactaccgctacctggcagaggtggcttccggcgagaagaaaaacagcgtg
gtcgaagcttcggaggcagcctacaaggaagccttcgaaatcagcaaggagcacatgcag
ccaacacaccccatccggctgggcctggccctcaacttctccgtgttctactacgagatc
cagaacgcgcccgagcaggcctgcctcttagccaaacaagccttcgatgacgccatagcc
gagctggacacactaaatgaggattcctataaggactccacgctcatcatgcagctgctg
cgagacaacctcaccctctggacgagcgaccagcaggacgaggaagccggagaaggcaac
tga

KEGG   Physeter catodon (sperm whale): 112062939
Entry
112062939         CDS       T06011                                 

Definition
(RefSeq) 14-3-3 protein homolog
  KO
K06630  14-3-3 protein epsilon
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04151  PI3K-Akt signaling pathway
pcad04390  Hippo signaling pathway
pcad04621  NOD-like receptor signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad05160  Hepatitis C
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112062939
   04151 PI3K-Akt signaling pathway
    112062939
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112062939
   04114 Oocyte meiosis
    112062939
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112062939
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112062939
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112062939
  09172 Infectious disease: viral
   05160 Hepatitis C
    112062939
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    112062939
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    112062939
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112062939
Exosome [BR:pcad04147]
 Exosomal proteins
  Proteins found in most exosomes
   112062939
SSDB
Motif
Pfam: 14-3-3 MKT1_N DUF4085 Med8 Peptidase_C98
Other DBs
NCBI-GeneID: 112062939
NCBI-ProteinID: XP_028344621
UniProt: A0A455BL47
LinkDB
Position
1
AA seq 193 aa
MKSLVENCLNEQHPKDELSVEERNLLSVAYKNAVGARRASWRIISSVEQKEMSKDHVQNQ
ALAAEYRKKVEQELNNICEDILRLLSEKLIPKTSDSESKVFYYKMKGDYFRYISEFSGDE
NKKQAADQAQESYQKATETAEAELPSTHPIRLGLALNYSVFFYEILNLPQQACEMAKRAF
DDAITEFDNVRGD
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaagagtctggttgagaattgtttgaacgagcagcacccaaaggacgagctgtccgta
gaggagaggaacctcctttcggtggcgtataaaaatgcggtgggagcccggcgagccagt
tggagaatcatttcttcggtcgagcagaaggagatgagcaaagaccatgtgcagaatcag
gctttggctgcagagtacagaaagaaggttgagcaggagttgaacaacatctgcgaagat
attttgagactcctgagtgaaaagctcattcccaaaacctccgacagcgagagcaaggtg
ttctactacaagatgaagggtgattatttccggtacatttcggaatttagcggcgatgag
aacaagaagcaggcagcagaccaggcgcaggaatcgtatcagaaagctacagagacagca
gaagcagagctgccctccacgcatccaatccgcttggggctcgcgctaaattattctgtt
ttcttctacgaaatcctcaacctcccgcagcaggcgtgtgaaatggccaaaagagccttc
gatgacgccatcaccgaatttgataacgtaaggggtgactaa

DBGET integrated database retrieval system