KEGG   Physeter catodon (sperm whale): 102980091
Entry
102980091         CDS       T06011                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05161  Hepatitis B
pcad05162  Measles
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05215  Prostate cancer
pcad05222  Small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102980091 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102980091 (CCNE1)
   04114 Oocyte meiosis
    102980091 (CCNE1)
   04115 p53 signaling pathway
    102980091 (CCNE1)
   04218 Cellular senescence
    102980091 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102980091 (CCNE1)
   05206 MicroRNAs in cancer
    102980091 (CCNE1)
   05203 Viral carcinogenesis
    102980091 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102980091 (CCNE1)
   05215 Prostate cancer
    102980091 (CCNE1)
   05222 Small cell lung cancer
    102980091 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102980091 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102980091 (CCNE1)
   05161 Hepatitis B
    102980091 (CCNE1)
   05162 Measles
    102980091 (CCNE1)
   05169 Epstein-Barr virus infection
    102980091 (CCNE1)
   05165 Human papillomavirus infection
    102980091 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcad03032]
    102980091 (CCNE1)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102980091 (CCNE1)
DNA replication proteins [BR:pcad03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102980091 (CCNE1)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102980091 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1
Other DBs
NCBI-GeneID: 102980091
NCBI-ProteinID: XP_023988555
UniProt: A0A2Y9TI46
LinkDB
Position
17
AA seq 410 aa
MPREKKERDGKEPGTMKEESGTDVSVRSRKRKANVAVFLQDPDEEVARIDRTVRSQCGSQ
PWDSNTVCENPCSLIPTPDKEEEELVYPNSAYKPQSCTPSRASPLPVLNWANREEVWKIM
LNKEKTYLRDKHFMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFSYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQVKKAILSEENRISPLPTGVLTPPQSSKKQSSGQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggaaaagaaggagagggatgggaaggaacccggcaccatgaaagaggaaagc
ggcaccgatgtctctgttcgctccaggaaaaggaaggcaaatgtggccgtttttttgcag
gatccagatgaagaagttgccagaattgacaggaccgtgagaagccagtgtggcagtcag
ccttgggacagtaatacagtctgcgaaaacccctgctccttgattcccacacctgacaaa
gaagaggaagagctcgtatacccgaattctgcatataagcctcagagttgcacaccatcc
agagcctcgccactgcctgtactgaactgggcaaatagagaggaagtatggaaaatcatg
ttaaacaaggaaaagacatacttgagggataagcactttatgcagcggcaccctcttctg
cagcctaaaatgcgagcgattcttctagattggttaatggaggtgtgtgaagtttataaa
cttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatgttgtaaaaacgcttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcttatgttacagatggggct
tgttcaggagatgaaattcttaccatggagttaatcattatgaaagcccttaagtggcat
ttaagtcccctgaccattgtgtcctggctgaatgtatacatgcaggtcgcatatctaaat
gatttttatgaagtgctcctgccgcagtatcctcagcaaatcttcatacagattgcagag
cttttagatctctgtgtcctggatgtcggctgcttagaattttcttatggggtacttgct
gcttctgccttgtatcatttctcttcatctgaattgatgcaaaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggaa
acaggaagttccaaacttaagcacttcaggggagttcctgctgaagatgcacacaacatc
cagacgcatataaacagcttggatttgctggacaaagcccaagtaaagaaagccatattg
tctgaagaaaataggatttctcctctccccactggggtcctcaccccgccgcagagcagt
aagaagcagagcagtgggcaaggaacagcatga

KEGG   Physeter catodon (sperm whale): 102988829
Entry
102988829         CDS       T06011                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04110  Cell cycle
pcad04114  Oocyte meiosis
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05161  Hepatitis B
pcad05162  Measles
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05215  Prostate cancer
pcad05222  Small cell lung cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102988829 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102988829 (CCNE2)
   04114 Oocyte meiosis
    102988829 (CCNE2)
   04115 p53 signaling pathway
    102988829 (CCNE2)
   04218 Cellular senescence
    102988829 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102988829 (CCNE2)
   05206 MicroRNAs in cancer
    102988829 (CCNE2)
   05203 Viral carcinogenesis
    102988829 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    102988829 (CCNE2)
   05215 Prostate cancer
    102988829 (CCNE2)
   05222 Small cell lung cancer
    102988829 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102988829 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102988829 (CCNE2)
   05161 Hepatitis B
    102988829 (CCNE2)
   05162 Measles
    102988829 (CCNE2)
   05169 Epstein-Barr virus infection
    102988829 (CCNE2)
   05165 Human papillomavirus infection
    102988829 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcad03032]
    102988829 (CCNE2)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102988829 (CCNE2)
DNA replication proteins [BR:pcad03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102988829 (CCNE2)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102988829 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102988829
NCBI-ProteinID: XP_007116739
UniProt: A0A2Y9F7K2
LinkDB
Position
15
AA seq 405 aa
MSRRSSRLQAKQQPQPSQTDSPQETQIIQAKKRKTAQDVKKRKEEKVVKKQQYEIRNCWP
PVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSQDVWLNMLK
KETRYVHDKHFEVLHSELEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAINSLEFQYRILAAA
ALCHFTSLEVVKKASGLEWDNISECVDWMVPFVSIVKSTSPVKLKVFKKISMEDRHNIQT
HTNYLAMLDEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccagcccagtcagacggac
tccccacaagaaacccagataattcaggccaagaagagaaaaacggcccaggatgtcaaa
aaaagaaaagaggagaaggtcgtcaagaaacaacagtatgagattaggaattgttggcca
cctgtattatctggggggatcagtccttgcattatcattgaaacaccccacaaagaaata
ggaacaagcgacttctccagatttacaaattacagatttaaaaatcttttcattaatcct
tcacctttgcctgatttaagctggggatgttcacaggatgtttggctaaacatgttaaaa
aaagagaccagatatgttcatgacaaacattttgaagttctgcattctgaattggaacca
cagatgaggtcaatacttctagactggcttttagaggtgtgtgaagtatacacacttcat
agggaaacattttatcttgcgcaagacttttttgatagatttatgttgacacaaaaggat
ataaataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaactt
gaggaaatctacgctcctaagctgcaagagtttgcttatgtcactgatggtgcttgcagt
gaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgt
cctgtaacagtcatctcctggctaaatctcttcctccaagttgatgctcttaaagatgct
cctaaagttcttctacctcagtattctcaggaaaagttcattcaaatagctcagctttta
gatctgtgtattcttgccatcaattcattagagttccagtacagaatactcgctgctgct
gccttgtgccattttacctctcttgaagtggttaagaaagcctcaggtttggaatgggac
aacatttctgaatgtgtagactggatggtgccttttgtcagcatagtaaaaagtactagc
ccagtgaagctgaaggtttttaagaagatttctatggaagacagacacaatatacagaca
catacaaattatctggctatgctggatgaagtaaattatataaacaccttcagaaagggg
ggacagttgtcaccagtttgcaatggaggcattatgacaccaccgaagagcactgaaaaa
ccaccaggaaaacactaa

DBGET integrated database retrieval system