KEGG   Physeter catodon (sperm whale): 102984840
Entry
102984840         CDS       T06011                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102984840
   04115 p53 signaling pathway
    102984840
   04218 Cellular senescence
    102984840
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102984840
   05206 MicroRNAs in cancer
    102984840
   05203 Viral carcinogenesis
    102984840
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102984840
   05225 Hepatocellular carcinoma
    102984840
   05214 Glioma
    102984840
   05220 Chronic myeloid leukemia
    102984840
   05218 Melanoma
    102984840
   05219 Bladder cancer
    102984840
   05223 Non-small cell lung cancer
    102984840
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102984840
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102984840
   05163 Human cytomegalovirus infection
    102984840
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102984840
   01522 Endocrine resistance
    102984840
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank DUF2384
Other DBs
NCBI-GeneID: 102984840
NCBI-ProteinID: XP_023988689
UniProt: A0A2Y9TJA7
LinkDB
Position
9
AA seq 152 aa
METSADWLATAAARGRADEVRALLEAGAPAHAPNRYGRSPIQVMMMGSARVAELLLLHGA
DPNCADPATLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWGRLPVDLAEEQGHRDVAR
YLRAAAGGTEGGSHARADSAEGPADSPALKNP
NT seq 459 nt   +upstreamnt  +downstreamnt
atggagacctcggctgactggctggccaccgccgccgcccggggccgggctgacgaggtg
cgggcgctgctcgaggcgggggcgccggcccacgcaccgaaccgttacggtcggagcccg
attcaggtcatgatgatgggcagcgcccgcgtagccgagctgctgctgctccacggtgcg
gaccccaactgcgcggaccccgccaccctcacccgacccgtgcacgacgccgcccgggag
ggcttcctggacacgttggtggcgctgcaccgagccggggcgcggctggacgtgcgcgac
gcctggggccgcctgcccgtggacctggctgaggagcagggccaccgcgacgtcgcccgc
tacctgcgcgcggctgcagggggcaccgaaggcgggagccacgcccgcgcagactccgcg
gaaggtcccgcagacagtcccgccctaaagaatccttga

DBGET integrated database retrieval system