KEGG   Physeter catodon (sperm whale): 102986270
Entry
102986270         CDS       T06011                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04934  Cushing syndrome
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05217  Basal cell carcinoma
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102986270 (AXIN1)
   04390 Hippo signaling pathway
    102986270 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102986270 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102986270 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102986270 (AXIN1)
   05225 Hepatocellular carcinoma
    102986270 (AXIN1)
   05226 Gastric cancer
    102986270 (AXIN1)
   05217 Basal cell carcinoma
    102986270 (AXIN1)
   05213 Endometrial cancer
    102986270 (AXIN1)
   05224 Breast cancer
    102986270 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102986270 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    102986270 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102986270 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102986270 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102986270 (AXIN1)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102986270 (AXIN1)
SSDB
Motif
Pfam: DIX Axin_b-cat_bind Sec16 DUF4808
Other DBs
NCBI-GeneID: 102986270
NCBI-ProteinID: XP_028355167
UniProt: A0A455C2C3
LinkDB
Position
14
AA seq 590 aa
MHEDVVWQLLTCLFVGRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADSLSLT
DSSVDGVPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRMPKEVRVEPQKFAAELIHRL
EAVQRTREAEEKLEERLKRVRMEEEGEDGDVSSGPPGASHKLPSAPAWHHFPPRYTDVSC
VGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSAHMPKMGVLGGTVPGHGKHM
PKSGAKLDTAGLHLHRHGHHHGHHGSARPKEPAEAEASRRVQSSFAWGPELHGHVAKPRS
HVESMGAATTTSDSLAYSGKASMTSKRNSKKAESGKSASVEAPGPSEDAEKNQKIMQWII
EGEKEISRHRKAGHGSSGAKKQQAHESSRPLSIERPGAVHPWVSAQLRTSVQPSHLFIQD
PTMPPNPAPNPLTQLEEARRRLEEEEKRASKAPSRQRYVQEVIQRGRSCVRPACTPVLSV
VPAVSDLELSETETKSQRKAGGGSAQSCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKE
LLTKKGNYRYYFKKVSDEFECGVVFEEVREDGAVLPVFEEKVIGKVEKVD
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgcacgaggatgttgtctggcagctgctaacgtgcctctttgttggcaggtatggatcc
tggcgggagcctgtcaacccctactacgtcaactccggttatgccctcgccccagccacc
agtgccaacgacagtgagcagcagagcctgtccagcgatgctgacagcctgtccctcacc
gacagcagcgtggatggagtcccaccttacaggatccgcaagcagcaccgccgggagatg
caggagagcgtccaggtcaacgggcgcgtgcctctacctcacattcctcgcacgtaccga
atgccaaaggaagtccgtgtggagccccagaagtttgccgcagagctcatccaccgcctg
gaggccgtgcagcggacgcgggaggctgaggagaagctggaggagcggctgaagcgcgtc
cggatggaggaagaaggtgaggatggtgatgtgtcctctggccccccaggggccagtcat
aagctgccttcagccccggcctggcaccacttcccaccccgctacacggacgtgagctgt
gtggggctgcgggacgcacacgaggagaaccctgagagcatcctggatgagcatgtgcag
cgagtcatgaggacaccgggctgccagtcaccggggcccggccaccgctccccggacagt
gcgcacatgcccaagatgggggtgctagggggcacagtgcccgggcatggaaagcacatg
cccaagtcgggggcaaagctggacacagctggcctgcacctccacagacacggccaccac
catggccaccatggctcagctaggcccaaggagccagccgaggccgaggcctcccgccgg
gtccagagcagcttcgcgtggggcccagagctgcacggccacgtggccaagccccgaagc
cacgtggagagcatgggcgccgccaccaccaccagtgacagcctggcctacagcgggaag
gcaagcatgacctccaaaagaaactccaagaaggccgagtcggggaagagcgccagcgtg
gaggcgccaggcccctctgaggacgcagagaagaaccagaaaatcatgcagtggatcatc
gagggcgagaaggagatcagcaggcaccggaaggctggccacgggtcgtccggggcaaaa
aagcagcaggcccacgagagctcccggcccttgtccatcgagcgccccggggccgtgcac
ccctgggtcagcgcccagctccggacctccgtgcagccctcgcatctcttcatccaggac
cccacgatgccgcccaacccggcccccaaccctctgacgcagctggaggaggcccgccgg
cgcctggaggaggaggagaagagggccagcaaggcgccctcgaggcagaggtatgtgcag
gaggtcatccagcgggggcgctcctgtgtcaggccagcgtgcacgcccgtgctgagcgtg
gtgccagcggtgtccgacctggagctctccgagacagagacaaaatcgcagaggaaggca
ggcggtgggagtgcccagtcgtgcgacagcatcgtcgtggcctactatttctgtggggag
cccatcccctaccggaccctggtgaggggccgtgcggtcaccctgggccagttcaaggag
ctgctgaccaagaaaggcaactacagatactacttcaagaaggtgagcgacgagttcgaa
tgcggcgtggtgttcgaggaggtgcgcgaggacggggctgtgctgcctgtcttcgaggag
aaggtcatcggcaaggtggagaaggtggactga

KEGG   Physeter catodon (sperm whale): 102990422
Entry
102990422         CDS       T06011                                 

Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04934  Cushing syndrome
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05217  Basal cell carcinoma
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102990422
   04390 Hippo signaling pathway
    102990422
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102990422
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990422
  09162 Cancer: specific types
   05210 Colorectal cancer
    102990422
   05225 Hepatocellular carcinoma
    102990422
   05226 Gastric cancer
    102990422
   05217 Basal cell carcinoma
    102990422
   05213 Endometrial cancer
    102990422
   05224 Breast cancer
    102990422
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102990422
   05022 Pathways of neurodegeneration - multiple diseases
    102990422
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102990422
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102990422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcad03036]
    102990422
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102990422
SSDB
Motif
Pfam: RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 102990422
NCBI-ProteinID: XP_028340805
UniProt: A0A455AVX3
LinkDB
Position
Unknown
AA seq 774 aa
MSSAVLVPRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGPVAKPLPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDAKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSVMFDQAQTEIQA
VMEDNAYQMFLTSDIYLEYVRSGGENPACVSSGGLGSLKLVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATVSVRSTETVENGYRRSDPVNPYHVGSGCVFAPATSANDSEIS
SDALTDDSVSMTDSSVDGIPPYLGGSKKQLQREMHRSVKANGQVCLPHFPRTHRLPKEMT
PVEPAAFAAELISRLEKLKLELEARHSLEERLQQIREVGAAPPPARGGGAPPADPGAPRP
CLAFQDEEKEGSELALSAREAGPAQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSP
GVGRYSPRARSPDQHRRHHLLQHRAPPPPGGPAAAPAGCPLFGARGFVSRQTTKHVHHHY
IHHHAGPRTREEVEAEAAPRARCPCPVPIPGGADYPCSAKCKSHPGAPEPAAAAQAGGRG
RGAVPPRRSGRGSEPGPAGPAREGGAPGGAGPLQPPGEEGDRAQDVWQWVLESERPGKAK
PHSAQSTKRAYPLECARASPAGRHHLWAGSSGHPRAAPRAHPFTQDPAVPPLTPPNTLAQ
LEEACRRLAEVSKPPKQRCCAASQQRDRHHSATGQPGATPFSSPSLASEDNKEQ
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgagcagcgctgtgttggtgcctcgcctcccagaccccagcagcagcttccgcgaggat
gccccgcggcccccagtgccgggcgaagaaggggagaccccaccgtgccagcccggggtg
ggaaagggcccggtcgccaaacccctgcctgtctcctccaatgccaggcggaatgaggac
gggttgggggagccggaggggcgggcgtctccggattcccctctgaccaggtggaccaag
tccctgcactccttgctgggtgaccaagacggtgcttatctcttccggactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggatgccaaaactttacgagtagccaaagcgatctacaagaggtacatcgag
aacaacagcattgtctccaagcagctgaaacctgccaccaagacctacatcagagatggc
atcaagaagcagcagatcgattctgtcatgtttgaccaggcgcagactgagatccaggcg
gtgatggaggacaacgcctaccagatgtttctgacttctgatatatacctcgaatacgtg
aggagtgggggtgaaaacccagcctgcgtgagcagcggggggctggggagcctgaagctt
gtgtgtggctacctgcccacgctgaacgaggaagaggagtggacttgcgccgacttcaaa
tgcaaactctcccccaccgtggttggcttgtccagcaaaactctgagggccacagtcagc
gtgaggtccacagaaacggtcgagaatggatacaggaggagcgatccggtgaatccgtac
cacgtgggttccggctgcgtcttcgcgccagccaccagcgccaacgacagcgagatatcc
agtgacgcgctgaccgacgattccgtgtccatgacggacagtagcgtagatggaatccct
ccttacctcggggggagtaagaaacagctccagagagagatgcatcgcagcgtgaaggcc
aacggccaggtgtgcctacctcatttcccgagaacccaccgcctgcccaaggagatgacc
cccgtggagcccgccgccttcgcggccgagctcatctcccggctggagaagctgaagctg
gagctggaggcgcggcacagcctggaggagcgcctgcagcagatccgagaggtgggcgcc
gccccgccccctgcccggggtgggggggcccctcctgctgaccccggcgcaccccgaccc
tgccttgccttccaggacgaggagaaggagggctccgagctggcgctgagtgcccgcgag
gcggggcccgcccagcaccccctctccctcctgccatcgggcagctacgaggaggacccg
cagaccatcctggacgaccacctgtccagggtcctcaagacccccggctgccagtccccg
ggcgtgggccgctacagcccccgcgcgcgctccccggaccagcatcgccgccaccacctc
ctgcagcaccgcgcgcccccgccccccgggggccccgccgccgcccctgccggctgcccc
ctcttcggggcccggggcttcgtgagcaggcagacgacgaagcacgtccaccaccactac
atccaccaccacgctggcccccggacccgggaggaggtggaggccgaggccgccccgcgc
gcgcgctgcccctgccccgtccccatccccgggggcgccgactacccctgcagcgccaag
tgcaagagccaccccggggcgccggagcccgcggcggccgcgcaggctggcggccgcggc
cgaggcgccgtcccaccccgacggagcggacgaggctcggagccgggcccggccgggcca
gcccgggaaggaggggcccccggcggagcggggccgctgcagccgcccggggaggaggga
gaccgggcgcaggacgtatggcagtgggtgctggagagcgagcggccgggcaaggccaag
ccgcacagtgcccaaagcaccaagcgggcctaccccttggagtgcgcgcgagcgtcccca
gccggccgtcaccacctgtgggcgggcagcagcgggcacccccgcgccgccccccgcgcc
cacccgttcacccaggaccctgcggtgcctcccctgaccccacccaacaccctggcgcag
ctggaggaggcctgccgccggctggcggaggtgtccaagcccccgaagcagcggtgctgc
gcggccagtcagcagagggacaggcaccactcggccactggtcagccaggagccacgccc
ttctccagcccaagcctggcttcggaagacaacaaggaacagtaa

DBGET integrated database retrieval system