KEGG   Physeter catodon (sperm whale): 102987258
Entry
102987258         CDS       T06011                                 

Definition
(RefSeq) neuroendocrine secretory protein 55-like
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04024  cAMP signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04724  Glutamatergic synapse
pcad04726  Serotonergic synapse
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04921  Oxytocin signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04962  Vasopressin-regulated water reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04972  Pancreatic secretion
pcad04976  Bile secretion
pcad05012  Parkinson disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05034  Alcoholism
pcad05142  Chagas disease
pcad05146  Amoebiasis
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102987258
   04020 Calcium signaling pathway
    102987258
   04072 Phospholipase D signaling pathway
    102987258
   04024 cAMP signaling pathway
    102987258
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102987258
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102987258
  09152 Endocrine system
   04911 Insulin secretion
    102987258
   04922 Glucagon signaling pathway
    102987258
   04923 Regulation of lipolysis in adipocytes
    102987258
   04912 GnRH signaling pathway
    102987258
   04913 Ovarian steroidogenesis
    102987258
   04915 Estrogen signaling pathway
    102987258
   04921 Oxytocin signaling pathway
    102987258
   04926 Relaxin signaling pathway
    102987258
   04935 Growth hormone synthesis, secretion and action
    102987258
   04918 Thyroid hormone synthesis
    102987258
   04928 Parathyroid hormone synthesis, secretion and action
    102987258
   04916 Melanogenesis
    102987258
   04924 Renin secretion
    102987258
   04925 Aldosterone synthesis and secretion
    102987258
   04927 Cortisol synthesis and secretion
    102987258
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102987258
   04270 Vascular smooth muscle contraction
    102987258
  09154 Digestive system
   04970 Salivary secretion
    102987258
   04971 Gastric acid secretion
    102987258
   04972 Pancreatic secretion
    102987258
   04976 Bile secretion
    102987258
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102987258
   04961 Endocrine and other factor-regulated calcium reabsorption
    102987258
  09156 Nervous system
   04724 Glutamatergic synapse
    102987258
   04728 Dopaminergic synapse
    102987258
   04726 Serotonergic synapse
    102987258
   04730 Long-term depression
    102987258
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102987258
  09159 Environmental adaptation
   04713 Circadian entrainment
    102987258
   04714 Thermogenesis
    102987258
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987258
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102987258
  09165 Substance dependence
   05030 Cocaine addiction
    102987258
   05031 Amphetamine addiction
    102987258
   05032 Morphine addiction
    102987258
   05034 Alcoholism
    102987258
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102987258
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102987258
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102987258
   05165 Human papillomavirus infection
    102987258
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102987258
   05142 Chagas disease
    102987258
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102987258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102987258
   04031 GTP-binding proteins [BR:pcad04031]
    102987258
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102987258
  Exosomal proteins of other body fluids (saliva and urine)
   102987258
  Exosomal proteins of colorectal cancer cells
   102987258
  Exosomal proteins of bladder cancer cells
   102987258
GTP-binding proteins [BR:pcad04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    102987258
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 102987258
NCBI-ProteinID: XP_028342916
UniProt: A0A455BG41
LinkDB
Position
Unknown
AA seq 241 aa
MDRRSRAQQGRRARHSYNDLCPPLGRRAATALLWLSCSIALLRALATSSTRAQQRAAAQR
RSFLNAHHRSAAQVFPEPPESDHEHEEPNLELSLPECLEYEEEFDYESETETESEIESET
DFETEPETAPATEPETEPEDERGPVVPKRRTFDQSLTERLNALRLQSPDASPRRAQPSTR
ESESPRQREEPEDKDPRDPEESEQPKEEKQRRRRCKPRKPTRRDPSPESPSKRGPIPIRR
H
NT seq 726 nt   +upstreamnt  +downstreamnt
atggatcgcagatcccgagctcagcaagggcgccgagctcgccacagttacaacgatctg
tgcccacccctaggccgccgggcagccaccgcactcctctggctctcctgctccatcgcg
ctccttcgcgcccttgccacctccagcacccgcgcccagcagcgcgccgctgcccagcgc
cggagcttccttaacgcccaccaccgctccgccgcccaggtattccccgagccccccgaa
tccgaccacgagcacgaggagccaaacctcgagctctccctccccgagtgcctggagtac
gaggaagagttcgactacgaatccgagaccgagaccgagtctgaaatcgagtcggagacc
gacttcgagaccgagcccgagaccgcccccgccactgagcccgagaccgagcccgaggac
gagcgcggccccgtggtgcccaagcgccgcaccttcgaccagtctctcactgagcgtctc
aacgccctgaggttgcagagccccgacgcctccccacgtcgcgcgcagcccagcactcgg
gagtccgagagccccagacaacgggaggagcccgaggacaaggatccgagggaccccgaa
gagtctgagcagccaaaggaggagaagcagcggcggcggcgctgcaagccgaggaagccc
acccgccgcgacccatctccggagtctccttccaaaaggggacccatccccatccggcgt
cactaa

KEGG   Physeter catodon (sperm whale): 102993267
Entry
102993267         CDS       T06011                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04024  cAMP signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04724  Glutamatergic synapse
pcad04726  Serotonergic synapse
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04921  Oxytocin signaling pathway
pcad04922  Glucagon signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04961  Endocrine and other factor-regulated calcium reabsorption
pcad04962  Vasopressin-regulated water reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04972  Pancreatic secretion
pcad04976  Bile secretion
pcad05012  Parkinson disease
pcad05030  Cocaine addiction
pcad05031  Amphetamine addiction
pcad05032  Morphine addiction
pcad05034  Alcoholism
pcad05142  Chagas disease
pcad05146  Amoebiasis
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102993267 (GNAS)
   04020 Calcium signaling pathway
    102993267 (GNAS)
   04072 Phospholipase D signaling pathway
    102993267 (GNAS)
   04024 cAMP signaling pathway
    102993267 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102993267 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102993267 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    102993267 (GNAS)
   04922 Glucagon signaling pathway
    102993267 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    102993267 (GNAS)
   04912 GnRH signaling pathway
    102993267 (GNAS)
   04913 Ovarian steroidogenesis
    102993267 (GNAS)
   04915 Estrogen signaling pathway
    102993267 (GNAS)
   04921 Oxytocin signaling pathway
    102993267 (GNAS)
   04926 Relaxin signaling pathway
    102993267 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    102993267 (GNAS)
   04918 Thyroid hormone synthesis
    102993267 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    102993267 (GNAS)
   04916 Melanogenesis
    102993267 (GNAS)
   04924 Renin secretion
    102993267 (GNAS)
   04925 Aldosterone synthesis and secretion
    102993267 (GNAS)
   04927 Cortisol synthesis and secretion
    102993267 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102993267 (GNAS)
   04270 Vascular smooth muscle contraction
    102993267 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    102993267 (GNAS)
   04971 Gastric acid secretion
    102993267 (GNAS)
   04972 Pancreatic secretion
    102993267 (GNAS)
   04976 Bile secretion
    102993267 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102993267 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102993267 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    102993267 (GNAS)
   04728 Dopaminergic synapse
    102993267 (GNAS)
   04726 Serotonergic synapse
    102993267 (GNAS)
   04730 Long-term depression
    102993267 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102993267 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102993267 (GNAS)
   04714 Thermogenesis
    102993267 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102993267 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102993267 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    102993267 (GNAS)
   05031 Amphetamine addiction
    102993267 (GNAS)
   05032 Morphine addiction
    102993267 (GNAS)
   05034 Alcoholism
    102993267 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102993267 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102993267 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102993267 (GNAS)
   05165 Human papillomavirus infection
    102993267 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102993267 (GNAS)
   05142 Chagas disease
    102993267 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102993267 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102993267 (GNAS)
   04031 GTP-binding proteins [BR:pcad04031]
    102993267 (GNAS)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102993267 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102993267 (GNAS)
  Exosomal proteins of colorectal cancer cells
   102993267 (GNAS)
  Exosomal proteins of bladder cancer cells
   102993267 (GNAS)
GTP-binding proteins [BR:pcad04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    102993267 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA GTP_EFTU AAA_29 TniB
Other DBs
NCBI-GeneID: 102993267
NCBI-ProteinID: XP_023984029
UniProt: A0A2Y9T7C3
LinkDB
Position
14
AA seq 395 aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFN
DVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAE
KVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggctgcctcggaaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgc
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccatcgtgaagcaaatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtagtgagaaggcaaccaaagtgcaggacatcaaaaacaacctg
aaagaggccattgaaaccatcgtggccgccatgagcaacctggtgccccccgtggagctg
gccaaccccgagaaccagttcagagtggactacattctgagcgtgatgaacgtgccagac
tttgatttccctcccgaattctacgagcacgccaaggctctgtgggaggacgagggggtg
cgcgcctgctacgagcgctccaacgagtaccagctcatcgactgcgcccagtacttcctg
gacaagattgacgtcatcaagcaggctgactatgtgcccagcgaccaggacctgctgcgc
tgccgtgtcctgacttctggaatctttgagaccaagttccaggtggataaagtcaacttc
cacatgtttgacgtgggcggccagcgtgatgaacgccgcaaatggatccagtgctttaat
gatgtgactgccatcatcttcgtggttgccagcagcagctacaacatggtcatccgggag
gacaaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaac
agatggctgcgcaccatctctgtgattctgttcctcaacaagcaagatctgctcgctgag
aaagtccttgctggaaaatcgaagattgaggactactttccagaatttgctcgctacact
actcctgaggatgcaactcccgagcctggagaggacccacgcgtgacccgggccaagtac
ttcattcgagatgaatttctgagaatcagcactgctagtggagacgggcgccactattgc
taccctcacttcacctgcgctgtggacacagagaacattcgccgtgtgttcaatgactgc
cgtgacatcatccagcgcatgcacctccgtcagtatgagctgctctaa

DBGET integrated database retrieval system