KEGG   Physeter catodon (sperm whale): 102989136
Entry
102989136         CDS       T06011                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00230  Purine metabolism
pcad01100  Metabolic pathways
pcad01522  Endocrine resistance
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04114  Oocyte meiosis
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04371  Apelin signaling pathway
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04714  Thermogenesis
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04727  GABAergic synapse
pcad04740  Olfactory transduction
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04918  Thyroid hormone synthesis
pcad04921  Oxytocin signaling pathway
pcad04923  Regulation of lipolysis in adipocytes
pcad04925  Aldosterone synthesis and secretion
pcad04926  Relaxin signaling pathway
pcad04927  Cortisol synthesis and secretion
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad04962  Vasopressin-regulated water reabsorption
pcad04970  Salivary secretion
pcad04971  Gastric acid secretion
pcad04972  Pancreatic secretion
pcad04976  Bile secretion
pcad05032  Morphine addiction
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102989136 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102989136 (ADCY3)
   04371 Apelin signaling pathway
    102989136 (ADCY3)
   04020 Calcium signaling pathway
    102989136 (ADCY3)
   04072 Phospholipase D signaling pathway
    102989136 (ADCY3)
   04024 cAMP signaling pathway
    102989136 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102989136 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102989136 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102989136 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102989136 (ADCY3)
   04062 Chemokine signaling pathway
    102989136 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102989136 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102989136 (ADCY3)
   04912 GnRH signaling pathway
    102989136 (ADCY3)
   04913 Ovarian steroidogenesis
    102989136 (ADCY3)
   04915 Estrogen signaling pathway
    102989136 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102989136 (ADCY3)
   04921 Oxytocin signaling pathway
    102989136 (ADCY3)
   04926 Relaxin signaling pathway
    102989136 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102989136 (ADCY3)
   04918 Thyroid hormone synthesis
    102989136 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102989136 (ADCY3)
   04916 Melanogenesis
    102989136 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102989136 (ADCY3)
   04927 Cortisol synthesis and secretion
    102989136 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102989136 (ADCY3)
   04270 Vascular smooth muscle contraction
    102989136 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102989136 (ADCY3)
   04971 Gastric acid secretion
    102989136 (ADCY3)
   04972 Pancreatic secretion
    102989136 (ADCY3)
   04976 Bile secretion
    102989136 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102989136 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102989136 (ADCY3)
   04727 GABAergic synapse
    102989136 (ADCY3)
   04725 Cholinergic synapse
    102989136 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102989136 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102989136 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102989136 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102989136 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102989136 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102989136 (ADCY3)
   04714 Thermogenesis
    102989136 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102989136 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102989136 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102989136 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102989136 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102989136 (ADCY3)
   05163 Human cytomegalovirus infection
    102989136 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102989136 (ADCY3)
Enzymes [BR:pcad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102989136 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 102989136
NCBI-ProteinID: XP_028352774
UniProt: A0A455BUV7
LinkDB
Position
12
AA seq 1216 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRKVVPYLLWLLITVQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQRDGLKGMQLLREILANVFLYLCAIVVG
IMSYHMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVRCAGCRPGLRAQDGGFGGVGGALRGSRVFLGTGNTATPQCER
GHLAARCWGRDGSRGPGPSLYRRHLRDNILFADIVGFTQLSSACSAQELVKLLNELFARF
DKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDM
RVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVE
PGDGGSRCDYLDEKGIETYLIIASKPEVKRTAAQNGLSGSALPNGAPPSSKPGSPALIET
KEPNGSIHTSGSTSEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLSEAL
LERESAQVACLHCRVKKRNTFFLSMRFMDREMETRYSVEKEKQSGAAFSCSCVVLLCTAL
VEILIDPWLMTNYVTFVVGELLLLILTVCSLAAIFPRAFPKKIVAFSTWIDRTRWARNTW
AMLAIFILVMANVVDMLSCLQYRMGPTNGSSGVQMEDGCVGNPKYYSCVAVLSLVATIML
VQVSHMVKLALMLLVAGAAAVINIYAWRPIFDEYDRRRFQEHDFPMVALEKTQVLSSPGL
NGTDRLPLVPSKCSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRW
NEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIE
CLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEKSDKE
RWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTV
NVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATF
PNGSSVTLPHQVVDNS
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgatcctgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctctgaccctgaccgcggggtgggccggacccatgagatctctgtc
cggaactcgggatcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctgtaccagacctacttcaaaaggcagcgccacgagacgctgctggtg
ctggtggtcttcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagtgacaagctggctccccttgctgtggccggggtcgggctggtgttggacatcatc
ctctttgtgctctgcaaaaaggggctgctgcccaaccgggtcacccggaaagtggtgccc
tacctgctgtggctgctgataacggtccaggtcttctcctacctgggcctgaacttctcc
cgcgcccatgcagccagcgacacggtgggctggcaggccttttttgtcttctcctttttc
atcacgctgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgcgtcgtg
cacacgctcgtcttgggggtcaccgtggcccagcagcagcgggacgggctgaaggggatg
cagttgctgagagagatcctggccaatgtcttcctgtacctgtgcgccatcgttgtgggc
atcatgtcctaccacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggcagacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcaggtgc
gccggctgcaggcctgggctccgagcgcaggacggaggctttgggggggtcggcggagca
ctgcggggttcgagagtcttcctgggcactggaaacacggccaccccacagtgtgagcgg
ggccaccttgctgccagatgttggggccgagatgggtcccgtggtccaggcccgtcattg
tacagacgccacctgcgagataacatcctctttgctgacattgtgggcttcacccagctg
tcttcagcctgcagcgcccaagagctcgtgaagctcctcaacgagctctttgcccgcttc
gacaagctggcggccaaataccaccagctgcggattaagattctgggcgactgttactac
tgcatctgtgggctgcctgactaccgggaggaccacgccgtctgctccatcctcatgggg
ctcgccatggtggaggccatctcgtatgtacgggagaagacgaagaccggggtggacatg
cgagtcggggtgcacacgggcaccgtgctggggggtgtcctgggccagaagcgctggcag
tacgacgtgtggtccaccgatgtcaccgtggccaacaagatggaggccggcggcatccct
gggcgcgtgcacatctcccagagcacgatggactgcctgaaaggcgagttcgacgtggag
ccaggtgacgggggcagccgctgtgattacctggatgagaagggcatcgaaacctacctc
atcattgcgtccaagccagaggtgaagaggacagccgcccaaaatggcctcagtggctcg
gctctgcccaacggagcgccgccttcctcaaagcccggctcccctgccctcattgagacc
aaggagcccaacgggagcatccacaccagcggctccacgtccgaggagccagatgcccag
gctgacaacccctcattccccaaccctcgccggaggctgcggcttcaggacctggccgat
cgcgtggtggacgcctccgaggacgagcacgagctcaaccagctgctcagcgaggccctg
ctggagcgggagtccgcccaggtggcttgtttgcactgcagagtgaagaagagaaacacc
ttcttcctgtccatgcggttcatggaccgcgagatggaaacccgctactcggtggagaag
gagaagcagagcggggccgccttcagctgctcctgcgtcgtcctgctctgtacggccctg
gttgagattctcatcgacccctggctaatgacaaactatgtgacctttgtggttggcgag
cttctgctcctcatcctgaccgtctgctcgctggctgccatctttcctcgggcctttccc
aagaagatcgtggccttctcgacttggatcgaccggacgcgctgggccaggaacacctgg
gccatgctggccatcttcattctggtcatggcaaacgtcgtggacatgcttagctgtctc
cagtaccgcatgggacccaccaatggcagctcaggggtgcagatggaggacggctgcgtg
gggaaccccaagtactacagctgcgtggccgtgctgtccctcgttgccaccatcatgctg
gtgcaggtcagccacatggtcaagctggcactcatgctgctcgtcgcaggggctgcggcc
gtcatcaacatctacgcctggcgccccatcttcgatgaatacgaccgcagacgcttccag
gaacacgactttccgatggtggccttagagaagacgcaggtactttccagccctgggctc
aatggcactgacaggctgcccttggtgccttctaagtgctcgatgacggtgatgatcttt
gtcatgatgctcagcttctactacttctcccgccacgtggagaagctggcacggacactg
ttcttatggaagattgaggtccacgaccagaaggaacgtgtctatgaaatgagacgctgg
aacgaagccttggtcactaacatgttgcctgagcacgtggcacgccatttcctggggtcc
aagaagagagacgaggagctgtacagtcagtcttatgacgagattggagtcatgtttgcc
tccctgcccaactttgctgacttctacacagaggagagcatcaataacggtggcattgag
tgtctgcgcttcctcaatgagatcatctcagattttgactctctcctggacaatcccaag
tttcgggtcatcaccaagatcaaaaccattggcagcacctacatggcagcttcaggagtc
accccagatgtcaacaccaatggctttaccagctccaacaaggagaagtcagacaaggag
cgctggcagcacctggcggatctggccgacttcgcgctcgccatgaaagacacgctcacc
aatatcaacaaccagtccttcaacaacttcatgttgcgcattggcatgaacaaaggaggg
gtactggctggtgtcatcggagcccggaaaccacactatgacatctggggcaatacagtc
aacgtagccagcaggatggagtccacaggggtcatgggcaacattcaggtggtggaagaa
actcaagtcatccttcgagagtacggcttccgctttgtgaggagagggcccatctttgtg
aaagggaagggggagctgctaacctttttcttgaaggggcgagagaagccagccacgttc
ccgaatggctcctcggttacactgccccaccaggtagtagacaactcctga

DBGET integrated database retrieval system