KEGG   Physeter catodon (sperm whale): 102990654
Entry
102990654         CDS       T06011                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04061  Viral protein interaction with cytokine and cytokine receptor
pcad04151  PI3K-Akt signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad04660  T cell receptor signaling pathway
pcad04672  Intestinal immune network for IgA production
pcad04940  Type I diabetes mellitus
pcad05135  Yersinia infection
pcad05142  Chagas disease
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05200  Pathways in cancer
pcad05320  Autoimmune thyroid disease
pcad05321  Inflammatory bowel disease
pcad05330  Allograft rejection
pcad05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102990654 (IL2)
   04151 PI3K-Akt signaling pathway
    102990654 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102990654 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102990654 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102990654 (IL2)
   04660 T cell receptor signaling pathway
    102990654 (IL2)
   04658 Th1 and Th2 cell differentiation
    102990654 (IL2)
   04659 Th17 cell differentiation
    102990654 (IL2)
   04672 Intestinal immune network for IgA production
    102990654 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990654 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102990654 (IL2)
   05321 Inflammatory bowel disease
    102990654 (IL2)
   05330 Allograft rejection
    102990654 (IL2)
   05332 Graft-versus-host disease
    102990654 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102990654 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102990654 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102990654 (IL2)
   05162 Measles
    102990654 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102990654 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102990654 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102990654 (IL2)
Cytokines and growth factors [BR:pcad04052]
 Cytokines
  Interleukins
   102990654 (IL2)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Haparin
  Cytokines
   102990654 (IL2)
SSDB
Motif
Pfam: IL2 Phage_terminase
Other DBs
NCBI-GeneID: 102990654
NCBI-ProteinID: XP_007116133
UniProt: A0A2Y9F6D3
LinkDB
Position
7
AA seq 154 aa
MYKMQLLSCIALTLALVANGAPTSSSTENTKEQVKSLLLDLRLLSNEVNNYENLKLFRML
TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNWTGIKDLMDNINRIVLTLKGS
ETRFTCEYDDETVTAVEFLEKWITFCQSIYSTMT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttgtcttgcatcgcactaactcttgcacttgtggcaaacggt
gcacctacttcaagctctacggagaacacaaaggaacaagtgaagtcattgctgctggat
ttacggttgctttcgaatgaagttaataattacgagaacctcaagctcttcaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca
gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactgg
acaggtatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct
gaaacaagattcacatgtgaatatgatgatgagacagtaaccgctgtagaatttctggaa
aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system