KEGG   Physeter catodon (sperm whale): 102990889Help
Entry
102990889         CDS       T06011                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00512  Mucin type O-glycan biosynthesis
pcad00514  Other types of O-glycan biosynthesis
pcad01100  Metabolic pathways
Module
pcad_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102990889 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    102990889 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pcad01003]
    102990889 (GALNT17)
Enzymes [BR:pcad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102990889 (GALNT17)
Glycosyltransferases [BR:pcad01003]
 O-Glycan biosynthesis
  Mucin-type
   102990889 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102990889
NCBI-ProteinID: XP_023978748
UniProt: A0A2Y9SK06
LinkDB All DBs
Position
14
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKGLKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDDSDEEELKAPLEEYVHKRYPGLVKVVRNRKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNSKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAVMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtggccggc
ttcgtgctcttcctggccaagtgccggcccatctcggtgcgcagcggagacgccttccac
gagattcggccgcgcgccgaggcggccaacctcagcgcgcacagcgccagccccatacag
gatgcggtcctgaagcgcctctcgctgctcgaggacattgtctaccggcaactaaatggt
ttatctaaatcccttgggctcattgaaggttatggtgggcggggcaaagggggccttcct
gctaccctttccccagctgaagaagagaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccaca
aagtgtaaggggctgaagtactccaaggagctgccccagatatccatcatatttatcttc
gtgaacgaggccctgtcggtgatcctgcggtccgttcacagcgcggtcaaccacacaccg
acccacctgctgaaggaaatcatcctggtggatgacgacagtgatgaagaggagctgaag
gcccctttggaggagtatgtccacaaacgctaccctgggctggtgaaggtggtgagaaat
cggaaaagagagggcctgatccgagcccgcatcgagggttggaaggtggccaccggccag
gtcaccggcttctttgatgcccacgtggaattcactgccggctgggccgagccagttctc
tcgcggatacaggagaaccggaagcgggtgatcctcccctccatcgacaacatcaaacag
gacaccttcgaggtgcagcggtatgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagcccgccgaaagactggtgggacgccggagacccttcccttcccatc
agaacaccagccatgattggctgctcgtttgtggtcaacaggaaattctttggtgaaatt
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctgtgcgggggcagcatggaggtcctgccttgctcacgagtggcccacatcgag
cggaagaagaagccatacaacagcaacatcggcttctacaccaagaggaatgctctccgg
gttgccgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaatctgcca
ctggagaatccaggaattgacataggtgatgtctcagaaagaaaagccttaaggaaaagt
ttgaagtgtaagaatttccagtggtacctggaccacgtctacccagaaatgagaagatac
aataacaccattgcctacggggagcttcgcaacagcaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatactgtacccatgccatggctggggaccccag
ctggcccgctacaccaaggagggcttcctgcacctgggagcgctagggaccaccacgctc
ctccctgacacccgctgcctggtggacaactccaagagtcgcctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaatggcgccgtc
atgaacaagggcacagggcgctgcctggaggtggagaaccgaggcctggctggcatcgac
ctcatcctccgcagctgcacgggacagaggtggacgattaagaacttcatcaagtag

DBGET integrated database retrieval system