KEGG   Physeter catodon (sperm whale): 102990905
Entry
102990905         CDS       T06011                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00220  Arginine biosynthesis
pcad00330  Arginine and proline metabolism
pcad01100  Metabolic pathways
pcad04020  Calcium signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04146  Peroxisome
pcad04371  Apelin signaling pathway
pcad04926  Relaxin signaling pathway
pcad05010  Alzheimer disease
pcad05014  Amyotrophic lateral sclerosis
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05133  Pertussis
pcad05140  Leishmaniasis
pcad05142  Chagas disease
pcad05145  Toxoplasmosis
pcad05146  Amoebiasis
pcad05152  Tuberculosis
pcad05200  Pathways in cancer
pcad05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102990905 (NOS2)
   00330 Arginine and proline metabolism
    102990905 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102990905 (NOS2)
   04066 HIF-1 signaling pathway
    102990905 (NOS2)
   04020 Calcium signaling pathway
    102990905 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102990905 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102990905 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990905 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102990905 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102990905 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102990905 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102990905 (NOS2)
   05152 Tuberculosis
    102990905 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102990905 (NOS2)
   05145 Toxoplasmosis
    102990905 (NOS2)
   05140 Leishmaniasis
    102990905 (NOS2)
   05142 Chagas disease
    102990905 (NOS2)
Enzymes [BR:pcad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102990905 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 102990905
NCBI-ProteinID: XP_028339626
UniProt: A0A455B6I3
LinkDB
Position
Unknown
AA seq 1156 aa
MREGLGAACEAARPRLCRLLRRILRPQPACGPRRASPVTQDDPKCHSLGKQQNDSPQPLT
GTAKQSPESLVKPAAPPSSCPQHVRIKNWSNGLTFQDTLYHKAKGDLACKSRSCLGAIVN
PKSLTIGPRDKPTLLDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYSTNNGNIR
SAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPANLEFTQLCIDLGWKPKYGR
FDVMPLVLQADGHDPELFEIPPDLVFEVPIEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVIEINVA
VLHSFQKHNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEML
NYVLSPFYYYQVEAWKTHVWQDERWRPRRREIRFKVLVKAVLFASVLMRETMASRVRATI
LFATETGRSETLARDLGALFSCAFNPKVLCMDEYRLSRLEEEQLLLLVTSTFGNGDSPGN
GEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLTPAGEGDE
LSGQEEAFRGWAVQTFKAACETFDVRGKHHIQIPKLYTANVTWDLHHYRLVQDSQPLDLN
KALSSMHARHVFTMRLKSRQNLQSPKSSRTTLLVELSCEGSQGPSYLPGEHLGVFPGNQP
ALVQGILERVVDGPAPHQPMCLETLCENGSYWVRDKRLPTCSLSQALTYFLDITTPPTQL
LLRKLAQLATDEAERQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQLP
VLKPRYYSISSSRDHTPTEIHLTVAVLTYRTRDGQGPLHHGVCSAWLSNLKPQDLVPCFV
RSASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQSGRMTLVFGCRRPDE
DHLYREEMLEMTRKGVLHEVHTAYSRLPNQPKVYVQDMLRQQLADEVLRVLHEDQGHLYV
CGDVRMARDVARTLKQLVATALSLTEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDGA
AGLPSNTRAPSAHRRS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgcgcgaggggctgggcgcggcgtgtgaggctgcccggccccgactctgccggctcctt
cgcaggatcctccggccgcagccagcctgcggcccccgccgagccagtccagtgacacag
gatgaccctaaatgtcacagcctcggcaagcagcagaatgactctccccagcccctcacg
gggacagcaaagcagtctccagaatccctggtcaagccggctgcacccccatcgtcctgt
ccacagcatgtgaggatcaaaaactggagcaacgggctgactttccaagacacgctttac
cacaaggccaaaggggatctcgcttgcaagtccaggtcttgcctgggagccatcgtgaac
cccaaaagtttgaccataggacccagggacaagcctaccctcctagacgagcttctacct
caagctattgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccagctg
acgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgccccccgctgcatc
gggaggatccagtggtccaacctgcaggtctttgacgcgcggagctgttccacggcccag
gagatgttcgagcacatctgcagacacctgcgttattccaccaacaacggcaacatcagg
tcggccatcaccgtgttcccccagcggagcgacgggaaacatgacttccgggtctggaac
gcccagctcatccggtacgccggctaccagatgcctgatggcaccatcagaggggaccct
gccaacctggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggccgc
ttcgatgtgatgcctctggtcctgcaggctgatggccacgaccctgagctcttcgaaatc
cctcccgaccttgtgtttgaggtgcccatagaacatcccaaatatgagtggttccgggag
ctggagctgaagtggtatgccctgccggccgtagccaacatgctgctcgaggtgggtggc
cttgagttcccagggtgccccttcaacggctggtatatgggcacggagatcggagtccgg
gacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggaggatgggcctg
gaaacacacaaggtggcctcactctggaaagaccgggctgtcattgagatcaatgtcgct
gtgctccacagtttccagaaacataatgtgaccatcatggaccaccactcagctgcagag
tccttcatgaagtacatgcagaatgagtaccggtcccgagggggctgcccagctgactgg
atttggctggtccccccaatttctggaagcatcacccccgtgttccaccaggagatgtta
aattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtctgg
caggatgagaggtggagaccccggagaagagagattcggttcaaagtcttggtcaaagcc
gtgctctttgcctcagtgctgatgcgtgagacaatggcttcccgggtcagagccacgatc
ctctttgcaacagagacgggaagatcagaaacactggcccgggacctaggggccttgttc
agctgtgccttcaaccctaaggttctctgcatggacgaatacaggctgagccgtctggag
gaggagcagctactgctgctggtgaccagcacgttcgggaacggagactcccccggcaac
ggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaagttcaggtat
gccgtgtttggcctcggctccagcatgtaccctcagttctgcgcctttgctcatgacatc
gaccagaagttgtcccagctgggggcttctcagctcaccccagcaggggaaggggacgag
ctcagcgggcaggaggaggccttccgtggctgggccgtgcaaaccttcaaggcagcctgt
gagacgttcgatgtccgaggcaaacaccacattcagatccccaagctctacactgccaac
gtgacctgggacctgcaccactacaggctcgtgcaagactcacagcctttggacctcaac
aaagccctcagcagtatgcacgccaggcatgtgttcaccatgaggctgaaatcgcggcag
aatctacagagtccaaaatccagccgtaccaccctcctggtggaactctcctgtgagggc
agccaaggtccaagctacctgccgggagagcacctcggagttttcccaggcaaccagcca
gccctcgtccaaggcatcctggagcgagtggtggatggccctgcaccccaccaacccatg
tgcctggagaccctctgcgagaacggcagctactgggtcagggacaagcggctgcccacc
tgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccagctg
ctgctccgaaagctggcccagctggccacggacgaggctgagaggcagaggctggagacc
ctgtgccagccatctgattacaacaagtggaagttcaccaatagccccaccttcctggag
gtgctggaggagttcccgtccctgcgggtgtccgccagcttcctgctctcccagctgcct
gtcctgaagccccggtactactccatcagctcctccagggaccacacacccacggagatc
cacctgactgtggccgtgctcacgtaccgcacccgagacggccagggtcccctgcaccac
ggcgtctgcagcgcatggctcagcaacctgaagccccaagacctggtgccctgctttgtg
cgaagtgccagcggcttccacctccccgaggacccctcccacccttgcatcctcatcggg
cctggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgatgccgag
cacaaaggtctccagagtggccgcatgaccctggtgtttgggtgccgccgcccagacgag
gaccacctctaccgggaagagatgttggagatgacccggaagggggtgctgcatgaggtg
cacacagcctattctcgcctgcctaaccagcccaaggtctacgttcaagacatgctgcgg
caacagctggcggacgaggtgctccgcgtgctccacgaggatcaaggccacctctacgtc
tgcggggacgtgcgcatggcccgggatgtggcccgcaccctgaagcagctggtggccacc
gcgctgagcctaactgaggagcaggtggaggactatttcttccagcttaagagccagaag
cgctatcatgaagatatctttggtgctgtatttccctatgaggtgaaaaaggatggggca
gcggggcttcccagcaataccagagctccaagcgcccacaggagaagttaa

DBGET integrated database retrieval system