KEGG   Physeter catodon (sperm whale): 102995068
Entry
102995068         CDS       T06011                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E-binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad03013  RNA transport
pcad04012  ErbB signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04218  Cellular senescence
pcad04910  Insulin signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05221  Acute myeloid leukemia
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102995068 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102995068 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    102995068 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    102995068 (EIF4EBP1)
   04152 AMPK signaling pathway
    102995068 (EIF4EBP1)
   04150 mTOR signaling pathway
    102995068 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102995068 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102995068 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    102995068 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102995068 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102995068 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102995068 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    102995068 (EIF4EBP1)
   05165 Human papillomavirus infection
    102995068 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102995068 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102995068 (EIF4EBP1)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102995068 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 102995068
NCBI-ProteinID: XP_007127533
UniProt: A0A2Y9FNF6
LinkDB
Position
20
AA seq 118 aa
MSSGSSCSQTPSRAIPATRRVVLGDGVHLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPVGDEPPTEASQDHLSSSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtcgagcggcagcagctgcagccagaccccaagccgggccatccccgccactcgccgg
gtggtcctcggcgacggcgtgcacctgccgcccggggactacagcaccacccccggcggc
acgctttttagcaccaccccgggaggtaccaggatcatctacgaccggaagttcctaatg
gagtgtcggaactcacctgtgaccaaaacgcccccgcgggacctgcccaccattcccggg
gtcactagccctgtgggtgatgagccccctacagaagccagccaggaccacctgagcagc
agcccagaggacaagccggcgggcggtgaagagtcacaatttgagatggacatttaa

DBGET integrated database retrieval system