KEGG   Physeter catodon (sperm whale): 102995328
Entry
102995328         CDS       T06011                                 

Gene name
ILK
Definition
(RefSeq) integrin-linked protein kinase
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03320  PPAR signaling pathway
pcad04360  Axon guidance
pcad04510  Focal adhesion
pcad05100  Bacterial invasion of epithelial cells
pcad05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102995328 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102995328 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    102995328 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    102995328 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102995328 (ILK)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102995328 (ILK)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: TKL group
  MLK family
   102995328 (ILK)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102995328 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 102995328
NCBI-ProteinID: XP_007103033
UniProt: A0A2Y9EJT9
LinkDB
Position
16
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKMLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaatgcggttgccgtccgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagaaggccgatctgctgtggtcgagatgctgatcatgcgcggggcacgaatc
aatgtgatgaaccgtggggatgacacccctctgcacctggcagccagtcatgggcaccgt
gatattgtacagaagctgctgcagtacaaagctgacatcaatgcagtgaatgagcatggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaggtggcagaggacctcgtg
gctaatggggcccttgtcagcatctgtaacaagtatggagagatgccggtggacaaagcc
aaggcacccttgagagagcttctccgagagcgggcagagaagatgggccagaatctgaac
cgtattccatacaaggacacattctggaaggggactacccgcactcggccccgaaatggg
actctgaacaaacactccggcattgacttcaaacagctcaacttcctggcgaagctcaat
gagaatcactctggagagctatggaagggccgctggcaggggaatgacatcgtcgtgaag
atgctgaaggttcgagactggagtacaaggaagagtagggacttcaacgaggagtgtccc
cggctcaggatcttctcccatccgaatgtgctcccagtgcttggcgcctgtcagtctcca
cctgctcctcaccccaccctcatcacacactggatgccatatggatccctgtacaacgtg
ctacacgaaggcaccaatttcgttgtggaccagagccaggctgtgaagtttgcactggac
atggcaaggggcatggccttcctacacacactagagcccctcatcccacgacatgcactc
aacagtcgtagtgtaatgattgatgaggacatgactgctcgaatcagtatggccgacgtc
aagttctccttccagtgccccggacgcatgtatgcgcctgcctgggtggcccctgaagct
ctgcaaaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaacatggaaatt
ggaatgaaggtggcattggaaggccttcggcctaccatcccaccaggcatttccccccat
gtatgtaaactcatgaagatctgcatgaatgaagaccctgctaagcggcccaagtttgac
atgattgtgcctatcctggagaagatgcaggacaagtag

DBGET integrated database retrieval system