KEGG   Physeter catodon (sperm whale): 102995983
Entry
102995983         CDS       T06011                                 

Gene name
BRCA2
Definition
(RefSeq) LOW QUALITY PROTEIN: breast cancer type 2 susceptibility protein
  KO
K08775  breast cancer 2 susceptibility protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03440  Homologous recombination
pcad03460  Fanconi anemia pathway
pcad05200  Pathways in cancer
pcad05212  Pancreatic cancer
pcad05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102995983 (BRCA2)
   03460 Fanconi anemia pathway
    102995983 (BRCA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102995983 (BRCA2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102995983 (BRCA2)
   05224 Breast cancer
    102995983 (BRCA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pcad04121]
    102995983 (BRCA2)
   03036 Chromosome and associated proteins [BR:pcad03036]
    102995983 (BRCA2)
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102995983 (BRCA2)
Ubiquitin system [BR:pcad04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    102995983 (BRCA2)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102995983 (BRCA2)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     102995983 (BRCA2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     102995983 (BRCA2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 102995983
NCBI-ProteinID: XP_007105518
UniProt: A0A2Y9EMN5
LinkDB
Position
13
AA seq 3425 aa
MPIGCKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPSEESDYKISSYETN
PFKTPQRKPYHQLASTPIIFKERGLTLPLYQSPLKELDKFRLDSGKDIASGKHKSCCTTK
AKMNQVNDVTSPPPNSSLSESPVVLRCTHVTPQREKSVICGSLFHTPKLMKGQTPKRISE
SLGAEVDPDMSWSSSLATPPTLSSTVLIVRDEEASATVFPNDSTAISKSYSSNHDESLKK
NITFIPSGPDSENKNQTEAKTHGLEKMLEDSFGKVNSCKDHFEKSMPNVLEDEVCETVAD
ISEEDSFPVCVSKYKTRNLQKIKTGKTRKNIFNETKTDEYEEVKIQMTENKHSFVSEMEP
NDSDPLDSNVINQKPLGNGTDKISREIVPSSVSEWSQLTLSGLNGSQMEKTSLLYISSCD
QNNSEEDIIGTEKERTNFITLENSLLHISSISKTVKILNEETVVKKRDEGQCLESHEDST
VVGKQALSDSSLIASPLQGIKKSVFRIKESPEKTFRADFSSNMTDANFKKEPEASKSGLE
VQTVCSQKEDSLHTSSVDDGSWPATTKHSSVALKNAGLIASLKKKTKKFIYAICDETSYQ
GLKMQKDQESELTNSSVQFEAKPLEAPHTFINVDSGLLHSSVKKNCLQNDSEEPALSVTS
SLGTIMRKCSNNESSSNNNKTISQDLDYKEAKINKEKLQSFITTETGYVSCLQEKHCEDD
PKSQRVSDVKEKVLPAVFHPALPHSEECSDILFQSQESFLHGHGSKDLLSNPVVISRGKE
SYRMSEKIKSENCEAGFELTKSISMEKNQETCVVNENSKNAELLSPEKYITEASPSMKVQ
FNQNTNLTVIQKDQEETTLISKITVTPNSEELFPDKENNFVIQTTTERNIPVLGNIKEVH
EADLSCLREPVPKNSAIVACTDIDDGQAAKVSITKDFGSSDVVRDLAEKNRNSVKQPPKM
TLGQDSKSYVSLDIDMKSNRNNDCMDKWAGLSDSISSHNFGSGFRTASNKEIKLSEHNIK
KSKMLFKDIEEHYPTSLACVEIVNTVSLENQKKGSRPRELDSQSVNTVSGYVQSSAVVSD
SGNSHTTPPVLSLKRDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSHMLQSN
PFEMPENQITVLNTISEECKDVDLHLTINAPSLSQVGSSKKCKGIVGDKQKLACLSTTNC
NKSASGYLTDKNEVEFRGFYSARGTKLNVSSEALQKAMKLFGDIENVSEETPAEVDPGSF
SSSQCNDSDASMFKVENYSNDKNLSEKNNECQLILQNNIEMTTGIFVKEYTEDYRRNTEN
DDNCTGFVCNLESDGNASNKNDTVYIHKDENGLPCIDQQNIHPKLSSQFMKEGYVQIKGL
SDLTCLEVVKAEETFNVNMSNKKESTANKMRQNKKDFDVFDLSFQTASGKNIRVSKESLN
KVVNFFDEKSAEELNNFSDSSNSELLSGVNINKIDISSHEETDMVKNKILKGGDPVGIKN
QVLTLQQRPECEIKKITEPTMLGFHTASGKKVKIAKESLDKVKNLFDEKKQDNSEITNFS
HHGAKMLKDREVCKEGLELACETVEITAPKHEEMQYSLEKKKLVSKETGMPPRLLSDHLY
RQTENLKISNSISLKVKVHENIEETRKSPITCYTDQSTCSAIENSALAFYTGRGRKISVS
QASLFEAKKWIREGELNNQLEKINSAKIICLKEYPGDCVGNPSCGNSSNSIITENDKNLS
EKQDSTSLSNSMSNNYSYHSDFSHSNELFNKSEYLSKNKSHNSDIESVVRNVKDRKNTSF
SEVISTVREANINPQAVDKDSCVQKLVTNSSPCKNKNTAVEVAISDSNNFETEQPAFSLA
SDKIAFVSHETKVRERFTDNCSNVTKQNTESESGTGRTKIVTGSHKALGDSEDIIFPNSP
DSEEHSMHSHEVFPNIQSEHILQHDQSISGLEKVSETPLCHINLKTSDKCKFNMGKCPKS
VSSINVCGIFSTASGKSVQVSDAALQKARQVFSKTEDSAKHLFSKVSFKSNEEHSNKFAR
EENTVMHTPQNLLSSAFSGFSTASGKHVLVSESAFCKVTGMFEEFDLIGTECSLQHSSPS
RQDVSKILPLSCIDKRTSEHSVSSKMGKAYNKEFKLSNNYNIESGSSENHAIKASPYLSQ
FKQDKQQLMSGTNVSHVENICLLGKEQALPKNIKMEIGKTETFPDLPMKTNTEVCSPNSK
DPENYFETEAVEIAKAFMEDDELTDSELLSHAKHSIFTCQKNEAVLINSGIGKRGGDVLV
TVGEPPIKRNLLNEFDRIIENQEKYLKASKSTPDGTMKDRRLFMHHISLEPVTCGPSCTS
TERRETQNPNFTASGQEFLSKSHFSEHLTLEKSSSTLSVSGQPLCKVPAPRNEKRRHSVT
TGKPMKVFVPPFKTKSHVHRDEQCVNRNTNFEENKQKQKNIDEHGSGDRENNVNDSEIHQ
TTTVLFTKGEEEPLDLIANLQTARDIQDMRIKMKQRQRIFPQPGSLYLAKTSTMPRISLK
VAVEGRVPTACSHKQLYRYGVSKHCVKINSKNAESFQFHTQDYFGKESLWAGKGIQLADG
GWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRVWVYNHYRWIIWKLAAMEFAFPKEFAN
RCLSPERVLLQLKYRYDMEIDRSRRSAIKKIMERDDTAAKTLVLCVSEIISLSTNVSETS
SSKTNSMDTTKVGVVELTDGWYAIKAQVDPPLLALLKNSRLTVGQKIIIHGAELVGSPDA
CTPLEAPESLMLKISANSTRPACWYAKLGFFSNPRPFPLPLSSLFSDGGNVGCVDIIIQR
AYPIQWMEKTSSGLYIFRNEREEEKEATKYAEAQQKKLEALFTKIQAEFEEHEENITERC
IPSRALTRQQVRALQDGAELYEAVKDSPDPSYLEGYFSEEQLRALNNHRRTLNDKKQAQI
HVELRKAMESAEQREQILPRDVTPVWKLRIMSCKRKEKDSVVLSIWRPSSDLYSLLTEGK
RYRIYHLAASKSKSKSERANIQLTATKKTQYQQLPASDEILLQVYQPREPLHFNKLLDPD
FQPPCSEVDLIGFVVSVVKKIGLAPLVYLSDECHNLLAIKFWIDLNADIIKPHMLIAASN
LQWRPESKSGIPTLFAGDFSMFSASPKEGHFQEMFHKMKNTIENMDIFCNDAENKLIRIL
NTNNPKWSTPTKDYTSAPHTAQTVLDTGNKFLVSSPSSEMNYQSPLSLCKLKGKSVSTPA
AAQMTSKSCCKGEKETDDPKNCKKRRALDFLSRLPVPPPVSPICTFVSPAAQKAFQPPRS
CGTKYETPMKKKELNSPQMTPLKKFNDISLLEGDSIADEELALINTQALLSGSAGENQLT
SISESTRTAPTSPKDHLGLKRPYTASVIKEQGNSPARTEEQKTNMQDTSTIKKTSKRLQR
RQKPK
NT seq 10278 nt   +upstreamnt  +downstreamnt
atgccgattggatgcaaagagaggccaacgttttttgaaatttttaagacgcgatgcaac
aaagcagatttaggaccaataagccttaattggtttgaagaactttcttcagaagctcca
ccctataattctgaaccttccgaagaatcagattataaaatcagcagttatgaaacaaac
ccatttaaaacaccacagaggaaaccttatcatcagttggcttcaactccaataatattc
aaagagcgaggtctaactctgccactgtaccaatctcctttaaaagaattagataaattc
agattagattcaggaaaggacattgccagtggtaaacataaaagttgttgcacaaccaag
gcgaaaatgaatcaagtgaatgatgttaccagcccacctccaaattcttctcttagtgaa
agtcctgtggttctacgatgtacacatgtaacaccacaaagagaaaagtcagtgatatgt
ggaagtttatttcatacaccaaagctcatgaagggtcagacaccaaaacgtatttccgaa
agtttaggagccgaggtggatcctgatatgtcttggtcaagttctttggccacaccacca
acacttagttctactgtgctcatagtcagagatgaagaagcatctgcaactgtatttcct
aatgatagtactgctatttcgaaaagctattcttctaaccatgatgaaagtctgaagaaa
aatattacgtttatcccttctgggccagacagtgaaaacaaaaatcaaacagaagctaaa
actcatggattggagaaaatgttagaggattcatttggtaaagtaaatagctgcaaagac
cattttgaaaagtcgatgccaaatgtcctagaagatgaagtatgtgaaacagttgcagat
atctctgaagaagatagttttccagtatgtgtttctaaatataaaacaagaaatctacaa
aaaataaaaactggcaagactaggaaaaatattttcaatgaaacaaaaaccgatgaatat
gaagaagttaaaatacaaatgacagaaaataaacattcgtttgtatctgaaatggagcca
aatgacagtgatccattagattcaaatgtaataaatcagaagccccttgggaatggaact
gacaaaatctccagggaaattgtaccatcttcagtgtctgaatggtctcagctaaccctc
tcgggtctaaatggaagccagatggagaaaacatccctactgtatatttcttcttgtgac
caaaataattcagaagaagacatcataggtacagagaaagaacgtaccaacttcattact
ttagaaaattctttgctgcatatttcaagcatatccaaaacagtgaagatattaaatgag
gaaacagtggtaaaaaagagagatgaagggcagtgtcttgagtctcatgaagattccact
gttgtgggaaagcaagcactatctgattcttctctaatagcttctccacttcagggtatc
aagaagtctgtattcaggataaaagaatcacctgaaaagactttcagagcagatttctca
agtaatatgactgatgcaaactttaaaaaagaaccagaagcctctaaaagtggattggaa
gtacaaactgtttgctcacagaaagaggattctttacatacaagttcagttgatgatggc
agctggccagccactaccaaacattcttctgtagctttgaagaatgcaggtttaatagcc
agtttgaaaaagaaaacaaaaaagttcatttatgctatatgtgatgaaacatcttatcaa
ggactgaaaatgcagaaagaccaagaatcagaactaactaactcttcagtgcaatttgaa
gccaagcctttggaagcaccacatacatttataaatgttgattcaggtttattgcattct
tctgttaaaaaaaactgtttacagaatgattctgaagaaccagctttgtctgtaaccagc
tctttggggacaattatgagaaaatgttctaataatgaaagcagttctaataataataaa
acaatatctcaggatcttgattataaagaagcaaaaattaataaggaaaaactgcagtca
tttataaccacagaaactggttatgtgtcatgcttgcaggaaaagcactgtgaagatgat
ccaaaaagccagagagtttcagatgtaaaggaaaaagtattgcctgcagtatttcaccct
gcattgccacattcagaggaatgtagtgatattctcttccaatcccaggaaagcttttta
catggccatggctccaaggatcttctgtcaaatccagttgtgatttctagaggaaaagaa
tcatatagaatgtcagagaaaataaaatctgagaattgtgaagctggttttgaattaacc
aaaagtatttccatggaaaagaatcaagaaacatgtgttgtaaacgaaaattctaaaaac
gctgagctgttgtcacctgaaaaatacataacagaagcatcaccttctatgaaggtacaa
ttcaaccaaaatacaaatctcacagtaatccaaaaagaccaagaagaaactactttaatt
tcaaaaataactgtcactccaaattctgaagaacttttcccagacaaagagaataatttt
gtcattcaaacaactactgaaaggaatattcctgttttaggaaacattaaggaagttcat
gaggcagacctcagttgtttaagagaacctgttcccaagaactctgccatagtagcatgt
acagacatagatgacggacaagcagccaaagtgtcgattacaaaagattttggttcatca
gatgtagtccgtgatcttgcagagaagaatagaaatagtgtaaagcaaccaccaaaaatg
actctgggtcaagattcaaagtcatatgtctcgttggatatagatatgaaatcaaacaga
aataatgattgcatggacaaatgggcaggactctcagattcgatttcaagtcacaatttt
ggaagtggcttcagaacagcttctaataaagaaataaagctctctgaacacaacattaag
aaaagtaaaatgctcttcaaagatattgaagaacattatcctactagcttagcctgtgtt
gaaattgtaaataccgtatcattagaaaatcaaaagaaaggaagcagacctcgtgaactt
gattcacagtcagttaatactgtatctgggtatgtgcagagtagtgcagttgtttctgat
agtggaaatagtcacacaactcctccagttttatctttaaaacgagactttaattcaaac
cataatttaacacctagccaaaaggcagaaattacagaactttctactatattggaagaa
tcaggaagtcagtttgaatttacacagtttagaaaaccaagccacatgttacagagtaat
ccatttgaaatgcctgaaaaccagataactgtcttgaataccatttctgaggaatgtaaa
gatgttgatcttcatctcacaattaatgccccatctctcagtcaggtaggtagcagcaag
aaatgtaaaggtatagttggagataagcaaaagttggcttgcttgtcaacaacaaactgt
aacaaaagtgcttctggttatttaacagataaaaatgaagtggagtttaggggcttttat
tctgcccgtggcacaaaactgaatgtttctagtgaagcattgcagaaagccatgaaactg
ttcggtgacattgagaatgttagtgaggaaactcctgcagaagtagatccaggaagtttc
tcttcaagtcagtgtaacgattctgatgcttcgatgtttaaggtagaaaattacagcaat
gataaaaatttaagtgagaaaaataatgaatgccaactaatactacaaaataacattgaa
atgactactggcatttttgtcaaagaatatactgaagactacaggagaaatactgaaaat
gatgataattgtactggttttgtttgtaacttagaatctgatggcaatgcttcaaataaa
aatgatacggtttatattcataaagatgaaaatggcttgccatgtattgatcaacaaaac
atacatccaaaattatctagccagtttatgaaggagggatacgttcaaattaaaggtttg
tcagatttaacttgtttggaagttgtgaaagctgaagaaacatttaatgttaacatgtca
aataaaaaagagtcaaccgctaacaagatgaggcaaaataaaaaagattttgatgttttt
gatttgtcctttcagactgcaagtgggaaaaacatcagagtctctaaagagtctttaaat
aaagttgtaaatttctttgatgaaaaatctgcagaagaactgaataacttttcagattcc
tcaaattctgaattactttctggcgtaaatatcaacaaaatagacatttcaagtcatgag
gaaacagatatggtcaaaaacaaaatattgaaaggaggtgacccagttggtattaaaaat
caagtactgactctccagcagagacctgaatgtgaaatcaaaaagatcacagaaccaacc
atgttgggttttcatacagctagtgggaaaaaagtaaaaattgccaaggaatctttggac
aaagtgaaaaatctttttgatgaaaaaaagcaagataatagtgaaatcactaatttcagc
catcatggggcaaagatgctaaaggacagagaggtatgtaaagaagggcttgaattagca
tgtgagacagttgaaataactgccccaaagcatgaagaaatgcagtattctctagagaag
aaaaagcttgtttctaaggagacaggcatgccacccaggctgttaagtgatcatttatac
agacaaactgaaaatctcaagatatcaaatagtatctctctgaaagttaaagtacatgaa
aatatagaagaaacaagaaaaagtcctataacttgttatacagatcagtccacttgttca
gccattgaaaattcagctttagccttttacacaggacgtggtagaaaaatttctgtgagt
caggcttcactatttgaagccaaaaaatggattagagaaggagaattgaataatcaacta
gaaaaaataaattctgccaagattatatgtttaaaggaatatcctggagattgtgtagga
aatccttcatgtggaaatagttcaaacagtatcataactgaaaatgacaaaaatctctct
gaaaaacaagattcaacttccttaagtaacagcatgtctaacaactattcatatcattct
gatttttctcattccaatgagttatttaataagtcagagtatctctcaaaaaataaaagt
cataattctgatattgagtcagtagtgaggaatgtcaaagataggaaaaacactagtttt
tctgaagtaatatccactgtaagagaagcaaacataaacccacaagctgtagacaaagat
agttgtgttcagaaacttgtgactaactcttcaccatgcaaaaataaaaacacagctgtt
gaagtggccatatctgattcgaataattttgagacagagcaacctgcattcagtttagca
agtgataagatagcctttgtttctcatgaaacaaaagtgagagagaggtttacagacaac
tgcagtaacgtaactaagcaaaacactgagagtgaatcaggcactggccgaacaaaaatt
gtgacaggttctcataaggcattgggtgattcagaggatattatttttcctaactctcca
gatagtgaagaacatagtatgcattcacacgaggtttttcctaacattcaaagtgaacac
attttacaacatgaccaaagtatatctggattggagaaagtgtctgaaacaccactttgt
catattaatttgaaaacttctgataaatgtaaatttaacatgggaaaatgtcccaagtca
gtctcttctataaatgtttgtgggatttttagcacagcaagtggaaaatctgtacaagta
tcagatgctgcattacaaaaggcaagacaggtattttctaagacagaagatagtgctaag
catctcttttccaaagtatcatttaaaagtaatgaagaacattcaaacaagtttgcaaga
gaagaaaatactgtgatgcataccccccaaaatttactgtcatctgctttctctggattt
agtacagcaagtggaaaacatgttctagtttctgagagtgccttttgcaaagttacggga
atgttcgaggaatttgatttaattggaactgaatgtagtcttcagcattcatctccatct
agacaagatgtatcaaagatacttcctctttcttgtattgataagagaacctcagaacac
tctgtaagctccaaaatgggaaaagcctataataaggaatttaaattatcaaacaactat
aacattgaaagtggttcttcagaaaatcatgctattaaagcttctccatatctctctcag
tttaagcaagacaaacaacagttgatgtcaggaaccaatgtatcacacgttgagaacatt
tgtcttttgggtaaagaacaagctttacctaaaaatataaaaatggaaattgggaaaact
gaaacttttcctgatcttcctatgaaaacaaatacagaagtttgttctcctaactccaaa
gatccagaaaactattttgaaacagaagcagtagagattgccaaagcctttatggaagat
gatgagctgacagattctgaacttctaagccacgccaaacactctatttttacatgccaa
aaaaacgaagcggttttgataaattcaggaattggaaaaagaggaggagatgtacttgtc
acagttggagaacccccaatcaaaagaaacttgttgaatgaatttgacaggataatagaa
aatcaagaaaaatacttaaaggcttcaaaaagcactccagatggcacaatgaaagataga
agattgtttatgcatcacatttctttagagccagttacctgtggaccttcttgcacaagt
acggaaaggcgagaaacgcagaatccaaatttcactgcatctggtcaagaatttctatct
aaatctcatttttctgaacacctgactttggaaaagtcttcaagcactttatcagtttca
gggcagccactttgtaaggttcctgccccaagaaatgaaaaaaggagacactcggtaact
acaggcaaaccaatgaaagtctttgtcccaccttttaaaactaaatcgcatgttcacaga
gatgaacagtgtgttaacaggaatactaattttgaggaaaacaaacagaaacaaaaaaac
atagatgaacatggctctggtgatcgtgaaaataatgttaacgacagtgaaattcatcaa
acaacaactgtgcttttcacaaagggtgaagaagaacctttagatttaattgcaaatctt
cagactgccagagatatacaggatatgcgaattaaaatgaaacaaaggcaacgtattttt
ccacagccaggtagtctgtatcttgcaaaaacatccactatgcctagaatctctctgaaa
gtagcagtagaaggccgagtccccactgcatgttctcataaacagctatataggtacggt
gtttctaaacattgtgtaaaaattaacagcaaaaatgcagagtcttttcagtttcacact
caggattattttggtaaggaaagtttatgggctggaaagggaatacagttggctgatggt
ggatggctcataccctccaatgatggaaaggctggaaaagaagaattttatagagctctg
tgtgacaccccaggtgtggatccaaagcttatttctagagtttgggtctataatcattat
agatggattatatggaaactggcagctatggaatttgcctttcctaaagaatttgctaat
agatgcctaagcccagaaagggtacttcttcaactcaaatacagatatgatatggaaatt
gatagaagcagaagatcagctataaaaaagatcatggaaagggatgacactgctgcaaaa
acgcttgttctctgtgtttctgaaataatttcattaagcacaaatgtatctgaaacttct
agcagtaaaactaatagtatggataccacaaaagtgggcgttgtcgaacttacagatgga
tggtatgctattaaggcccaggtggatcctcccctcttagctctcttaaagaacagtaga
ctaactgtgggtcagaagatcataattcacggagcagagctggtgggctctcctgatgcc
tgtactcctcttgaagccccagaatctcttatgttaaagatttctgctaacagcactcgg
cctgcttgctggtatgccaaactcggattcttttccaatcctagaccttttcctcttccc
ttgtcatcacttttcagcgatggaggaaatgttggttgtgttgatataattattcaaaga
gcataccctatacagtggatggagaagacatcatctggattatacatatttcgcaatgaa
agagaagaagaaaaggaagcaacaaaatatgcagaagcccagcaaaagaaactggaagcc
ctattcactaaaattcaagcagaatttgaagagcatgaagaaaatataacagaacgatgt
ataccatcacgtgcactaacaagacagcaagtccgtgctttgcaagatggtgcagaactt
tatgaagctgtgaaggattcaccagacccaagttaccttgagggttattttagtgaagag
cagttaagagccttgaataatcacagacggacgttgaatgataagaagcaagcccagatc
catgtggaactcaggaaggctatggagtctgctgagcaacgggaacagattttaccaaga
gacgttacacctgtgtggaagctgcgtatcatgagctgtaagagaaaggaaaaagattca
gttgtgttgagtatctggcgtccatcatcagatttatattctctcttaacagagggaaag
agatacagaatctatcatcttgcagcatcaaaatctaaaagtaaatccgaaagagctaac
atacagttaacagcaacaaaaaaaacgcagtatcaacaactaccggcttcagatgaaatt
ctattacaagtttatcagccaagggagccgcttcacttcaacaaattattggatccagac
ttccagccaccttgttctgaggtggacctaataggatttgtagtttctgttgtgaaaaaa
ataggtcttgctcctttggtctatttgtcagatgaatgccataatttattggcaataaag
ttttggatagatcttaatgcagacattattaaacctcacatgttaattgctgcaagcaac
ctccagtggcgaccagagtccaaatcaggaatccctactttatttgctggagatttttcc
atgttttctgccagtccaaaggagggccattttcaagaaatgttccacaaaatgaaaaat
actattgagaatatggatatattttgcaatgatgcagaaaacaagcttattcgtatactt
aatacaaataatcccaagtggtccaccccaactaaagactatacttcagcaccacacact
gctcaaacagtccttgatacaggaaataagtttctggtgtcttctcccagtagtgagatg
aattatcaaagtccgttatcactttgtaagctaaaagggaagtctgtctccacacctgca
gcagcccaaatgacttcaaagtcttgttgcaaaggggagaaagagactgatgacccaaaa
aactgcaaaaagagaagagccttggatttcttgagcagattgcctgtacctccacctgtt
agtcccatttgtacatttgtttctccagctgcacagaaggcatttcagccaccacggagt
tgtggcaccaaatatgaaacacctatgaagaaaaaagaattgaattctcctcagatgact
ccacttaaaaaatttaatgacatctctcttttggaaggtgattcaatagctgatgaagaa
cttgccctgataaatacccaagcccttttgtctggttcagcaggagaaaatcaacttaca
tctatcagtgagtccactaggactgctcccactagtccaaaagatcatctcggactgaaa
aggccttacactgcatctgtgatcaaagaacaagggaattccccagccaggactgaagaa
cagaagactaatatgcaggacacaagtacaataaaaaaaacatccaagagactgcaaagg
cgacaaaaaccaaaatga

DBGET integrated database retrieval system