KEGG   Paraburkholderia caffeinilytica: DSC91_001274Help
Entry
DSC91_001274      CDS       T06448                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcaf  Paraburkholderia caffeinilytica
Brite
KEGG Orthology (KO) [BR:pcaf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DSC91_001274
Enzymes [BR:pcaf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DSC91_001274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like K_oxygenase Glutaredoxin FAD_oxidored NAD_binding_8 Thi4 DAO FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AXL49451
UniProt: A0A346B882
LinkDB All DBs
Position
1:1344588..1346180
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKSYLEKVSRPIEIVASLDDSAKSQELLALLSDIATLSERVSVIERRGDSE
RKPSFSIGEPGKETGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFMNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKSYEVDIMDVQRAEALIPGRINE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLFEFGAQLRADEVLQRKLRSLANVTIVTQAQTTEITGDGKKV
NGLVYKDLRSGETKSIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRSSDADEVVSEAETEATV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaatctcaagactcagttgaaatcctacctcgaaaaggttagcaggcct
atcgagatcgtcgcgtcgctcgacgacagcgcgaaatcgcaagagctgctggcattgctg
agcgatatcgcgacgttgtcggaacgcgtcagcgtgatcgaacgtcgtggcgacagcgag
cgcaagccgtcgttttcgatcggcgagcccggcaaggaaacgggcattcgtttcgccggc
attccgatggggcatgaattcacgtcgctcgtgcttgcgcttttgcaggtcggcggccat
ccggtcaaactcgacgatgcggtgatcgaacagatccgcagcctcgacggcgactatcag
ttcgaaacgtatttttcgctgtcatgccagaactgcccggaagtcgtccaggcactgaac
gtgatggcgctgatcaacccgcgcatccgccacgtggcaatcgacggcgcgctgttccag
aacgaagtcgaagcacgccagatcatggcggtaccgaccatgttcatgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgccaagctcgacaccaacgccggt
gcgcgcgctgccaaggaactggaaaagaagccggtgttcgatacgctgatcgtcggcggt
gggcctgcgggcgcggctgcggcgatttactcggcacgcaagggtattgcgaccggtgtc
gtggcggaacgcttcggcggtcaggtgctcgatacgctcgcgatcgagaacttcgtttcc
gtgacggaaaccgaaggaccgaagttcgccacggcgctcgaacagcacgtgaagagctac
gaagtcgacatcatggacgtgcagcgcgccgaggcgctgatccccggccgcatcaacgaa
gtgcgtctcgcgaacggcgcggtgctgaaggcgaagacgatcattctggccacgggcgcc
cgctggcgcgagatcaacgtgccgggcgagcgcgagtaccgtaaccacggcgtggcgtac
tgcccgcactgcgatggtccgctgttcaagggcaagcgtgtggcggtgatcggcggcggc
aactcgggcgtcgaggcggcgatcgacctcgcgggcatcgtgcgcgaagtgacgctgttc
gaattcggcgcgcaattgcgtgctgacgaagtgctgcaacgcaagctgcgcagcctcgcc
aacgtgacgatcgtcacgcaggctcagaccacggaaatcaccggcgacggcaagaaggtc
aacggtctggtctacaaggacctgcgttcgggtgaaacgaaaagcatcgaactcgaaggc
gtcttcgtacagatcggtctcgtgccgaataccgaatggctgaagggcacggtcgaattg
tcgaagcacggcgagatcgtcgtcgatgcccgcggcgcaacgtcggtgccgggcgtgttt
gccgccggcgacgtgaccaccgtcccgttcaagcagatcgtgattgcggtgggcgagggc
gcgaaggcatcgctctccgcgttcgatcacctgatccgcagcagcgacgcggatgaagtg
gtgagcgaagctgaaaccgaagcgacagtttga

DBGET integrated database retrieval system