KEGG   Mixta calida: C2E16_10480Help
Entry
C2E16_10480       CDS       T05419                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcd  Mixta calida
Brite
KEGG Orthology (KO) [BR:pcd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2E16_10480
Enzymes [BR:pcd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2E16_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored FAD_binding_3 HI0933_like Thi4 NAD_binding_8 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AUY25290
UniProt: A0A654QTM9
LinkDB All DBs
Position
2219149..2220717
Genome map
AA seq 522 aa AA seqDB search
MLDTTMKNQLKAYLEKLTKPVELIATLDDGAKSAEIRELLGEIAELSDKVSFREDNALPV
RKPSFLITNPGNTTGPRFAGSPLGHEFTSLVLALLQTGGHPSKETQALLEQIRQLDDDLH
FETYYSLSCHNCPDVVQALNLMAILNPRISHTAIDGGVFQSEIQDRNVMGVPAVFLNGKE
FGQGRMSLAEIVSKVDVNADKRAADELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTAL
LGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVSEYAIDVIDSQSASKLVPAKVEG
GLHAIETASGAVLKSRSIIVATGARWRNMNVPGEEQYRTRGVTYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPTMKADAVLQEKARSLENVDIILNAQTLEVKGD
GSKVTSLEYKDRVNETVHQIDVAGIFVQIGLLPNTTWLDGAIERNQMGEILIDAKCETNV
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTQPVG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccacgatgaaaaaccaactcaaggcctatcttgagaaattaacgaagcct
gttgagttaatcgccaccctggacgacggcgctaaatccgctgaaatcagagaactgctg
ggcgaaatcgccgaactctctgacaaggtgtcgttccgcgaagacaacgcgctgccggtg
cgtaaaccgtcatttctgatcaccaacccaggcaacacgaccggcccgcgtttcgccggt
tcgccgctgggtcacgaatttacctcgctggtgctggcgctgttgcagaccggcggtcat
ccgtctaaagagacgcaggcgctactggagcagatccgccagctggacgacgacctgcat
ttcgaaacttactactcgctctcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggcgatcctgaacccgcgcatcagccacacggcgatcgacggcggcgtcttccag
agcgaaatccaggaccgcaacgtcatgggcgtgccggcggtattcctgaacggcaaagag
ttcggccaggggcgcatgagcctggcggaaatcgtcagcaaagttgacgtcaatgccgac
aaacgcgccgcggatgagctgaacaagcgcgacgcctacgacgtgctgatcgtcggcagc
ggccctgcgggcgcggcggcagcaatctactccgcgcgtaaaggcatccgcaccgccctg
ctgggcgagcgcttcggcggtcaggtgctggataccgtcgatatcgaaaactatatctcc
gtgccgaaaaccgaaggcgcgaagctggccggcgcgctgaaagcgcacgtcagcgaatac
gctatcgacgtcatcgacagccagagcgccagcaaactggtgccggcgaaagtagaaggc
ggcctgcacgctatcgaaaccgcctccggcgcggtgctgaaatctcgcagcatcatcgtg
gcgaccggcgcgcgctggcgcaacatgaacgtaccgggcgaagaacagtatcgcacccgc
ggcgtgacctactgcccgcactgcgacggcccgctttataaaggcaaacgcgtggcggtg
atcggcggcggcaactccggtgtggaagccgcgatcgacctggccggcatcgttgagcat
gtcaccctgctggagttcgcgccgaccatgaaagcggacgcggtgctccaggaaaaagcg
cgcagtctggaaaacgtggatatcatcctcaacgcgcagacgctggaagtgaaaggcgac
ggcagcaaagttaccagcctggaatataaagatcgcgttaacgagacggtgcatcagatc
gacgtggcgggcattttcgtgcagattggcctgctgccgaacaccacctggctggacggc
gcgattgagcgcaaccagatgggcgaaatcctgatcgacgccaagtgcgaaaccaacgtc
aaaggcgtgttcgccgccggcgactgcaccacggtgccgtacaagcagatcatcatcgcc
agcggcgaaggcgcgaaagcctcgctcagcgcgtttgactatctgatccgtacgcagccg
gtaggctaa

DBGET integrated database retrieval system