Proteus terrae subsp. cibarius: F9282_01200 Help Entry F9282_01200       CDS       T06330                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pcib  Proteus terrae subsp. cibarius Pathway pcib02024   Quorum sensing pcib03018   RNA degradation Brite KEGG Orthology (KO) [BR:pcib00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     F9282_01200 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     F9282_01200 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcib03019]     F9282_01200 (hfq)    03036 Chromosome and associated proteins [BR:pcib03036]     F9282_01200 (hfq) Messenger RNA biogenesis [BR:pcib03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      F9282_01200 (hfq) Chromosome and associated proteins [BR:pcib03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     F9282_01200 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  QGW01684 LinkDB All DBs Position 232955..233242 Genome browser AA seq 95 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNTGTNQTGTGYNGGAAQQDDVAE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatcctttcctgaacgcattacgtcgtgaaagggtt cccgtttctatctatttggtaaacggcattaaattgcagggtcagatcgaatcttttgac caatttgttattttgctgaaaaacacagtaagtcagatggtatacaaacatgctatctct accgtggtaccttcgcgtcctgtttctcatcatagcaacacaggcacgaaccaaactggt acaggctacaatggtggcgctgctcagcaggatgatgttgcagaataa

DBGET integrated database retrieval system