KEGG   Proteus cibarius: F9282_05715
Entry
F9282_05715       CDS       T06330                                 

Gene name
trxB
Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
pcib  Proteus cibarius
Pathway
pcib00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:pcib00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    F9282_05715 (trxB)
Enzymes [BR:pcib01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     F9282_05715 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 K_oxygenase FAD_oxidored Thi4 FMO-like NAD_binding_8 Trp_halogenase NAD_binding_7
Other DBs
NCBI-ProteinID: QGW02509
LinkDB
Position
complement(1247481..1248440)
AA seq 319 aa
MSTIKHSKLIILGSGPAGYTAAVYAARANLEPVLITGVEKGGQLTTTTEVENWPGDPEGL
TGPGLMDRMFQHAEKFNTEIISDHINKVDLKNRPFRLFGDEQEYTCDALIIATGASARYI
GLPSEESFKGRGVSACATCDGFFYRNQKVAVVGGGNTAVEEALYLSNIASEVHLIHRRDS
FRSEKILINRLMDKVNSGNIILHTDRTLDEVLGDDMGVTKVRLKDTKSDKTEELDVMGVF
IAIGHSPNTAIFDGQLELDNGYIKVQSGTQGNATQTSIEGVFAAGDVMDHIYRQAITSAG
TGCMAALDAERYLDALKSN
NT seq 960 nt   +upstreamnt  +downstreamnt
atgagcaccatcaaacatagcaaacttattattttaggttcaggccctgcgggttatacc
gccgccgtttatgctgcaagagcaaacttagaaccagtactgattacgggtgttgaaaaa
ggcggtcagctgacaacaacaacagaagtcgaaaactggcccggagaccctgaggggcta
acaggtcctggcttaatggaccgcatgtttcagcacgctgagaaatttaatacagagatt
atctctgaccatattaataaagtcgatctgaaaaaccgcccattccgcctatttggtgat
gaacaagaatacacttgtgacgcattaattatcgcaacgggtgcttctgcacgctatatc
ggtttaccttcagaagaatcttttaaaggccgaggcgtttctgcttgtgcaacctgtgat
ggttttttctatcgtaaccaaaaagttgccgttgtcggtggcggaaatacggctgtagaa
gaagctctttatttatctaatattgcatcagaagttcatctgatccaccgtcgtgattct
ttccgttctgaaaagatcttaattaaccgtttaatggataaagtaaacagtggcaatatt
attttgcatactgatcgtaccttagacgaagttcttggcgatgatatgggtgtaacgaaa
gttcgcttaaaagacactaagagtgataaaaccgaagaattagatgttatgggcgtcttt
attgcgattggacatagccctaacaccgctatttttgacggtcaattagaattagacaac
ggttacatcaaagtacaatcaggtactcaaggtaatgcaacacaaacctctatcgagggt
gtttttgcagctggtgacgtaatggatcacatttatcgtcaagcaattacctctgctggc
acaggctgtatggctgctttagatgcagaacgttacttagacgcactaaaatccaactaa

DBGET integrated database retrieval system