Paraburkholderia caledonica: CUJ87_01390 Help Entry CUJ87_01390       CDS       T05740                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pcj  Paraburkholderia caledonica Brite KEGG Orthology (KO) [BR:pcj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pcj03110]     CUJ87_01390 (grxC) Chaperones and folding catalysts [BR:pcj03110]  Protein folding catalysts   Protein disulfide isomerase    CUJ87_01390 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AXF13217 UniProt:  A0A2Z5M9L2 LinkDB All DBs Position PHRS4_A:312712..312972 Genome browser AA seq 86 aa AA seqDB search MNKVIMYSTQVCPYCQMAERLLKSRGVENIEKVLIDKDPARREEMMTRTGRRTVPQVFIG ETHVGGYDDLSALDRAGGLTPLLEAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaagtgatcatgtacagcacacaggtgtgcccgtattgccagatggccgaacgt cttttaaagtcgcgcggcgtcgagaatatcgaaaaagtactgatcgacaaggacccggcc cgtcgtgaggagatgatgacccggaccggtcgtcgcacggtgccgcaggtgttcatcggc gagacgcacgttggcgggtatgacgatctctccgcgctcgatcgcgcgggcggtctgacg cctctgctcgaagccgcctga

DBGET integrated database retrieval system