Pseudomonas coronafaciens pv. oryzae: POR16_17410 Help Entry POR16_17410       CDS       T08147                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pcof  Pseudomonas coronafaciens pv. oryzae Brite KEGG Orthology (KO) [BR:pcof00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcof03036]     POR16_17410 (ftsB) Chromosome and associated proteins [BR:pcof03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     POR16_17410 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB Csm1_N YabA ACCA_BT HALZ Motif Other DBs NCBI-ProteinID:  QGL59678 LinkDB All DBs Position complement(3885920..3886198) Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLGGLQYRLWVGNGSLAQVASLTQQIADQHAENEVLLERNRVLDAEV MELKKGLETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcctaactggttgttcctcgtcctgctcttgttgctgggtggcttgcaatac cgtctttgggtcggtaacggcagccttgcgcaagtggccagcctgactcagcagattgcc gaccagcacgctgagaatgaggtgctgctcgagcgcaatcgcgtactcgatgcagaagtc atggagctgaaaaaaggcctggagaccgttgaggagcgcgcccggcatgaactgggcatg gtcaaggacggcgaaaccctttaccagctcgcgcaataa

DBGET integrated database retrieval system