KEGG   Phascolarctos cinereus (koala): 110195467
Entry
110195467         CDS       T05867                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X1
  KO
K02158  Bcl-2-antagonist of cell death
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04140  Autophagy - animal
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04370  VEGF signaling pathway
pcw04510  Focal adhesion
pcw04722  Neurotrophin signaling pathway
pcw04910  Insulin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw05010  Alzheimer disease
pcw05014  Amyotrophic lateral sclerosis
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05165  Human papillomavirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110195467 (BAD)
   04014 Ras signaling pathway
    110195467 (BAD)
   04370 VEGF signaling pathway
    110195467 (BAD)
   04024 cAMP signaling pathway
    110195467 (BAD)
   04022 cGMP-PKG signaling pathway
    110195467 (BAD)
   04151 PI3K-Akt signaling pathway
    110195467 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110195467 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    110195467 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110195467 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110195467 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110195467 (BAD)
   04919 Thyroid hormone signaling pathway
    110195467 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110195467 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110195467 (BAD)
   05203 Viral carcinogenesis
    110195467 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110195467 (BAD)
   05212 Pancreatic cancer
    110195467 (BAD)
   05225 Hepatocellular carcinoma
    110195467 (BAD)
   05221 Acute myeloid leukemia
    110195467 (BAD)
   05220 Chronic myeloid leukemia
    110195467 (BAD)
   05218 Melanoma
    110195467 (BAD)
   05211 Renal cell carcinoma
    110195467 (BAD)
   05215 Prostate cancer
    110195467 (BAD)
   05213 Endometrial cancer
    110195467 (BAD)
   05223 Non-small cell lung cancer
    110195467 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110195467 (BAD)
   05014 Amyotrophic lateral sclerosis
    110195467 (BAD)
   05020 Prion disease
    110195467 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    110195467 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110195467 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110195467 (BAD)
   05161 Hepatitis B
    110195467 (BAD)
   05160 Hepatitis C
    110195467 (BAD)
   05162 Measles
    110195467 (BAD)
   05168 Herpes simplex virus 1 infection
    110195467 (BAD)
   05165 Human papillomavirus infection
    110195467 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110195467 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110195467 (BAD)
   01524 Platinum drug resistance
    110195467 (BAD)
   01522 Endocrine resistance
    110195467 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 110195467
NCBI-ProteinID: XP_020823920
UniProt: A0A6P5IP97
LinkDB
Position
Unknown
AA seq 175 aa
MSMFQISEFEPSEQENPKEDGFACAPGESRGLGKHSTTAPSLAPVRPGPRPAPGAHHHEG
AGDRRPRLISYPPLREGFGEASPEAEPEAEWSEGEEERGLFRSRSSSAPPILWAARRYGS
ELRRMSDEFDCTFKGLPRPKSAGTTSQMRRSHGWARTFQSWFTRNLGKGGAGPSH
NT seq 528 nt   +upstreamnt  +downstreamnt
atgagcatgtttcagatctcagagtttgagcccagtgagcaggaaaatcccaaagaagac
ggctttgcctgtgccccaggggagtccagggggctgggcaaacacagcaccactgccccc
agcctggccccagtcaggcctggacccagacccgcacctggagcccaccaccatgagggc
gcaggggacaggaggccccgcctgatctcctaccccccacttcgggaggggttcggggag
gcgagtcccgaagcggagcccgaggcagagtggtccgagggggaggaggagcgcggcctg
ttccggagccgctccagctcagcgccccctatcctctgggctgcgcggcgttatggcagc
gagttgcgcaggatgagcgacgagttcgattgcaccttcaagggtcttccacgcccgaag
agcgccggcactacgagccagatgcgtcggagccacggctgggcccggaccttccagtct
tggttcacccggaatttggggaaagggggcgccggtccttcccactga

DBGET integrated database retrieval system