KEGG   Phascolarctos cinereus (koala): 110195790
Entry
110195790         CDS       T05867                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04110  Cell cycle
pcw04114  Oocyte meiosis
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05161  Hepatitis B
pcw05162  Measles
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05215  Prostate cancer
pcw05222  Small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110195790 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110195790 (CCNE2)
   04114 Oocyte meiosis
    110195790 (CCNE2)
   04115 p53 signaling pathway
    110195790 (CCNE2)
   04218 Cellular senescence
    110195790 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110195790 (CCNE2)
   05206 MicroRNAs in cancer
    110195790 (CCNE2)
   05203 Viral carcinogenesis
    110195790 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110195790 (CCNE2)
   05215 Prostate cancer
    110195790 (CCNE2)
   05222 Small cell lung cancer
    110195790 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110195790 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110195790 (CCNE2)
   05161 Hepatitis B
    110195790 (CCNE2)
   05162 Measles
    110195790 (CCNE2)
   05169 Epstein-Barr virus infection
    110195790 (CCNE2)
   05165 Human papillomavirus infection
    110195790 (CCNE2)
DNA replication proteins [BR:pcw03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110195790 (CCNE2)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110195790 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110195790
NCBI-ProteinID: XP_020824361
UniProt: A0A6P5IZH4
LinkDB
Position
Unknown
AA seq 462 aa
MPGPERRDEKGVSSSAPLFPPEPRVWAPRPAAAGTLRVEEKDQARREPEASKNPKKKMSR
RSSRLQAKQQPQTSQTDSPPETQFLQAKKRKTAQDVKKRKEETVAKRQQYEIRNCWPSVL
SGGITPCIIIETPHKETVTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKDVWFNMLKKET
KYVHDKHFEMLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINK
NMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEDDILGMELIILKALKWELCPVT
VIAWLNVFLQVDALKDVPKVLLPQYSQEKFVQIAQLLDLCILSIDSLEFQYRILAAAALC
HFTSIEVVKKASGLEWDNISECVEWMVPFARVVKGGPPVKLKVFKKISVEDRHNIQTHTN
YLAMLEEVNYVSAFTKVGQLSPVCSGGIMTPPKSTEKSPGKH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgccggggccggagaggagagacgagaaaggagtctcttcttcagctcccttgttcccc
ccagagcctagggtctgggccccgcggcctgcggccgccggcacccttcgcgtagaggaa
aaggaccaggcgaggcgggagccagaagcttcgaagaacccaaagaaaaaaatgtcaaga
agaagtagccgactgcaagctaagcagcagccacagaccagtcaaacagattcccccccg
gaaactcaattccttcaagccaaaaaaaggaaaacagctcaggatgtaaagaaaagaaaa
gaggagactgtggccaagagacagcaatatgaaattaggaattgctggccatctgtgtta
tctgggggtatcactccttgcattattattgaaacaccacacaaagaaactgtcaccagt
gacttctccagatttactaattataggtttaaaaaccttttcataaatccttcacctctg
cctgacctaagttggggatgttctaaggatgtctggtttaatatgttaaaaaaggagacc
aaatatgttcatgacaaacattttgaaatgctacactctgacttagaaccacagatgagg
tcaatacttctggactggcttttagaggtatgtgaagtatatacacttcacagggaaaca
ttttatcttgctcaagacttttttgatagatttatgttgacacaaaaggatataaacaaa
aatatgcttcagctcattggtattacctcattattcattgcttcaaaacttgaggaaatc
tatgctcctaaattacaagaatttgcttatgtcacggatggtgcttgcagtgaagatgat
atcctggggatggaactcattatattaaaggctttaaagtgggaactctgtccagtaaca
gtcattgcctggctgaatgtctttcttcaagtcgatgctctaaaagatgttcctaaagta
ctcctacctcagtattcccaggaaaagtttgttcaaatagcccagctcctggatctgtgt
attctctccattgattcattagaattccagtataggatattggctgcagctgctttatgc
cattttacctctattgaagttgttaagaaagcttcaggtttagagtgggacaacatttca
gaatgtgtagaatggatggtaccttttgccagagtagtgaagggtggtcctccggtgaaa
ttgaaggtttttaagaagatttctgtagaagacagacacaatatccagacacacacaaat
tacttggctatgctggaggaagtcaattatgtgtcagctttcacaaaagtaggacagtta
tcaccagtgtgcagtggaggcatcatgacaccaccgaagagcacagaaaaatccccagga
aaacactaa

KEGG   Phascolarctos cinereus (koala): 110207433
Entry
110207433         CDS       T05867                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04110  Cell cycle
pcw04114  Oocyte meiosis
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05161  Hepatitis B
pcw05162  Measles
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05215  Prostate cancer
pcw05222  Small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110207433 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110207433 (CCNE1)
   04114 Oocyte meiosis
    110207433 (CCNE1)
   04115 p53 signaling pathway
    110207433 (CCNE1)
   04218 Cellular senescence
    110207433 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110207433 (CCNE1)
   05206 MicroRNAs in cancer
    110207433 (CCNE1)
   05203 Viral carcinogenesis
    110207433 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110207433 (CCNE1)
   05215 Prostate cancer
    110207433 (CCNE1)
   05222 Small cell lung cancer
    110207433 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110207433 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110207433 (CCNE1)
   05161 Hepatitis B
    110207433 (CCNE1)
   05162 Measles
    110207433 (CCNE1)
   05169 Epstein-Barr virus infection
    110207433 (CCNE1)
   05165 Human papillomavirus infection
    110207433 (CCNE1)
DNA replication proteins [BR:pcw03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110207433 (CCNE1)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110207433 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110207433
NCBI-ProteinID: XP_020840726
UniProt: A0A6P5K7V1
LinkDB
Position
Unknown
AA seq 735 aa
MSRESGSEECQGKEEFNQDVKEDHVDEKEEPSPDELVNGKEEPSHDELMNGIHERSPDVL
MNGTHEPSPDELFDGEEDPSIDELVYGDDDPSFDEVIYEEEDPNPNELVCEEEGASLDEL
VCEEEGASLDELVCEEEDPHADELICEEENPNPDELMCDEEDTVDEEDASPEELICDEED
PNADELICEEEGPNSDELICEEEGPNLDDLICEEEIPHPDDEDFICEEEDPQPIDLIYEE
EDPSFHELICGEQDPSLHELFDGRDEPRPNGREGPSPDGREDPSPDGREDPNPDSRQDPS
AGELFDGKKNQSPSEHAEGTEERSPDGKEDGWNGKEEENKKRGIEPGREQSGGGSTESSR
SRKRKADVAVFLLDPDEVLAKRETIGRTAVRIPAFLRNPWSVILTPDKGGDEPSLPNSNM
PTHNFSQHRATPLPLLGWANRDEVWKIMLSKEQVYLRDKNFMERHPSLQPRMRSILLDWM
MEVSEVYKLHRETYYLAQDFFDRYMATQRNITKTLLQLIGITSLFIAAKLEEIYPPKLYQ
FAYVTDGACTEEEILTMELIIMKALKWRLSPMTLVSWLNVYMQVAYLNDLYEEVLMPQYP
QQIFVQVAELLDVCILDMGCFDFTYGVLAASALYHFSSTEIMKKVSGFDWPEVEDCVKWM
VPFAMAVKEVGGARLKYFKGVPSEDMHNIQTHVNTINLLDRAYEKQAMLADERVSAPTGV
LTPPQSDKKPSKEQE
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgtccagagaaagcggttctgaggaatgccaggggaaggaggaatttaaccaggatgtg
aaggaagatcatgttgatgagaaggaagagccaagccccgatgagcttgtgaatgggaag
gaagagccaagccacgatgagcttatgaatggtatacatgagcggagccccgatgtgctt
atgaacgggacgcacgagccaagcccggatgagctctttgatggggaggaagatccaagt
attgatgagcttgtctatggggatgatgatccaagctttgatgaagttatctatgaggag
gaagatccaaaccctaatgagcttgtctgtgaggaggaaggtgcgagcttagatgagctt
gtctgtgaggaggaaggtgcgagcttagatgagcttgtctgtgaggaagaagacccccat
gctgatgagctgatctgtgaagaggaaaatcccaaccccgatgagcttatgtgtgatgag
gaagacaccgttgatgaggaagatgccagtccagaagagcttatctgtgatgaggaagat
cccaatgcagatgagcttatctgtgaggaagaaggcccaaactcagatgagcttatctgt
gaggaggaaggcccaaaccttgatgatcttatctgtgaggaggaaatcccacaccctgat
gatgaggactttatttgtgaggaggaagacccacagcctattgatctcatctatgaggag
gaagatccaagcttccacgagctcatctgtggggagcaagacccaagtctccatgagctt
tttgatgggagagatgaaccaagaccaaatgggagggaaggccccagccctgatggcagg
gaagacccaagccctgatggcagggaagacccaaatcctgatagcaggcaggatccgagt
gctggtgagctctttgacgggaagaaaaaccaaagtcccagtgagcatgctgaagggacg
gaggaaagaagccctgatgggaaggaagatggctggaatgggaaagaggaagagaacaag
aagaggggtattgagcccggaagagagcaaagtggtggtggctcaacagaatcctcccgc
tcccggaaaagaaaggccgatgtagctgtgtttttgctggatccagatgaagtattggcc
aaaagggaaacaattggaagaactgcagtcaggataccggcttttctcagaaatccgtgg
tcagtgattctcacacctgacaaaggaggggatgagccatcattacctaattctaatatg
ccaacccacaacttctcacaacatagagctacaccattaccattattgggctgggcaaat
agagatgaggtttggaaaatcatgttaagcaaagaacaggtatacctgagggataagaac
tttatggagagacatccttctctacagccaagaatgcgatccatccttctggattggatg
atggaggtgtctgaagtctataaacttcacagggagacgtattacttggcacaagacttc
tttgatcgatatatggcaacacagcgaaatattacaaaaacacttctgcagcttattggg
attacctcattatttatagctgccaaacttgaggaaatctatccaccaaagctgtaccag
tttgcttatgtgacagatggagcttgtacagaggaagaaattcttaccatggaattaatc
attatgaaggcccttaagtggcgtttaagtccaatgacacttgtgtcctggctaaatgta
tacatgcaggttgcttatctcaatgacctgtatgaagaagtgctcatgccacagtatcct
cagcaaatctttgtgcaggtggccgagcttttagatgtctgcatcctggatatgggctgc
tttgattttacttatggagtgctggctgcatctgccttatatcatttctcttccactgag
ataatgaaaaaagtttcaggctttgattggccagaagtagaggactgtgtgaagtggatg
gtcccatttgctatggctgtaaaggaagtaggaggagccagactcaaatatttcaagggt
gttcctagtgaagacatgcataacattcagactcatgtgaacaccataaatttgctggac
agagcttatgaaaagcaagccatgctggctgatgagagagtgtctgctcccactggagtc
ctcacaccaccacagagtgataagaaacctagcaaagagcaggagtga

DBGET integrated database retrieval system