KEGG   Phascolarctos cinereus (koala): 110195907
Entry
110195907         CDS       T05867                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110195907 (GADD45G)
   04064 NF-kappa B signaling pathway
    110195907 (GADD45G)
   04068 FoxO signaling pathway
    110195907 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110195907 (GADD45G)
   04210 Apoptosis
    110195907 (GADD45G)
   04115 p53 signaling pathway
    110195907 (GADD45G)
   04218 Cellular senescence
    110195907 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110195907 (GADD45G)
   05202 Transcriptional misregulation in cancer
    110195907 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110195907 (GADD45G)
   05212 Pancreatic cancer
    110195907 (GADD45G)
   05225 Hepatocellular carcinoma
    110195907 (GADD45G)
   05226 Gastric cancer
    110195907 (GADD45G)
   05214 Glioma
    110195907 (GADD45G)
   05216 Thyroid cancer
    110195907 (GADD45G)
   05220 Chronic myeloid leukemia
    110195907 (GADD45G)
   05217 Basal cell carcinoma
    110195907 (GADD45G)
   05218 Melanoma
    110195907 (GADD45G)
   05213 Endometrial cancer
    110195907 (GADD45G)
   05224 Breast cancer
    110195907 (GADD45G)
   05222 Small cell lung cancer
    110195907 (GADD45G)
   05223 Non-small cell lung cancer
    110195907 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110195907 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110195907 (GADD45G)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110195907 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110195907 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110195907
NCBI-ProteinID: XP_020824495
UniProt: A0A6P5IQU2
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEIHSQEMVTESTNRMQSAGKALNELLLSAQRQGCLTAGVYESAKVMNVDPDNVTFC
VLGADEEDEGDIALQIHFTLIQAFCCENDIDIVRVNNIQKLAEIIGANEDSGEPQDLHCI
LITNPNENSWKDPALEKLSLFCEESRNVNDWVPTITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaaatccacagccaggagatggttaccgaaagcaccaataggatgcag
agcgccgggaaagcattgaacgagctgctgctgtctgcccaacgccagggctgccttact
gcaggcgtgtatgagtctgctaaagtcatgaatgtcgatccagataatgtgactttttgt
gtcctgggtgcagatgaggaagatgaaggggacattgctctgcaaattcacttcactctc
attcaagctttctgttgtgaaaatgacatcgatattgttagagtcaacaatatccagaag
ctggcagagattataggtgctaatgaggattctggagagccccaagacctacactgcatc
ttaatcacaaatcccaatgagaattcctggaaagatccagctttggaaaaactaagcttg
ttctgtgaggagagccgaaatgtaaatgactgggtacccactatcactctgcctgaatga

KEGG   Phascolarctos cinereus (koala): 110212964
Entry
110212964         CDS       T05867                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110212964 (GADD45A)
   04064 NF-kappa B signaling pathway
    110212964 (GADD45A)
   04068 FoxO signaling pathway
    110212964 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110212964 (GADD45A)
   04210 Apoptosis
    110212964 (GADD45A)
   04115 p53 signaling pathway
    110212964 (GADD45A)
   04218 Cellular senescence
    110212964 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110212964 (GADD45A)
   05202 Transcriptional misregulation in cancer
    110212964 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110212964 (GADD45A)
   05212 Pancreatic cancer
    110212964 (GADD45A)
   05225 Hepatocellular carcinoma
    110212964 (GADD45A)
   05226 Gastric cancer
    110212964 (GADD45A)
   05214 Glioma
    110212964 (GADD45A)
   05216 Thyroid cancer
    110212964 (GADD45A)
   05220 Chronic myeloid leukemia
    110212964 (GADD45A)
   05217 Basal cell carcinoma
    110212964 (GADD45A)
   05218 Melanoma
    110212964 (GADD45A)
   05213 Endometrial cancer
    110212964 (GADD45A)
   05224 Breast cancer
    110212964 (GADD45A)
   05222 Small cell lung cancer
    110212964 (GADD45A)
   05223 Non-small cell lung cancer
    110212964 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110212964 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110212964 (GADD45A)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110212964 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110212964 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110212964
NCBI-ProteinID: XP_020848807
UniProt: A0A6P5KUI3
LinkDB
Position
Unknown
AA seq 171 aa
MTLEEFAAGEQKTEGMDKVGDALEEVLSKALSQRSITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLGTGGSAAATAAAASGG
GAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 516 nt   +upstreamnt  +downstreamnt
atgactttggaggaattcgcggccggagaacagaaaactgaagggatggacaaggtcggg
gatgccctggaggaggttctcagcaaagccttgagtcagcgaagtatcacggttggggtc
tacgaggcggcgaaactgctcaatgtggaccccgataacgtggtgctgtgcctgctggcc
gcggacgaggatgacgatcgggacgtggccctgcagatccatttcaccctcatccaggct
ttctgctgcgaaaatgacatcaacatcctgcgggtcagcaaccccgggcgcctggctgag
ctgctgctgttggggacaggtggctcggcggccgccaccgcagcggccgcctccggcggg
ggagccgagcagcccccggacctgcactgcgtcctggtgacgaacccacattcctctcaa
tggaaggatccggccttaagtcaacttatttgtttttgccgggaaagccgatacatggat
cagtgggtgccggtgattaacctccctgaacggtga

KEGG   Phascolarctos cinereus (koala): 110223449
Entry
110223449         CDS       T05867                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110223449 (GADD45B)
   04064 NF-kappa B signaling pathway
    110223449 (GADD45B)
   04068 FoxO signaling pathway
    110223449 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110223449 (GADD45B)
   04210 Apoptosis
    110223449 (GADD45B)
   04115 p53 signaling pathway
    110223449 (GADD45B)
   04218 Cellular senescence
    110223449 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110223449 (GADD45B)
   05202 Transcriptional misregulation in cancer
    110223449 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110223449 (GADD45B)
   05212 Pancreatic cancer
    110223449 (GADD45B)
   05225 Hepatocellular carcinoma
    110223449 (GADD45B)
   05226 Gastric cancer
    110223449 (GADD45B)
   05214 Glioma
    110223449 (GADD45B)
   05216 Thyroid cancer
    110223449 (GADD45B)
   05220 Chronic myeloid leukemia
    110223449 (GADD45B)
   05217 Basal cell carcinoma
    110223449 (GADD45B)
   05218 Melanoma
    110223449 (GADD45B)
   05213 Endometrial cancer
    110223449 (GADD45B)
   05224 Breast cancer
    110223449 (GADD45B)
   05222 Small cell lung cancer
    110223449 (GADD45B)
   05223 Non-small cell lung cancer
    110223449 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110223449 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110223449 (GADD45B)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110223449 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110223449 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110223449
NCBI-ProteinID: XP_020864656
UniProt: A0A6P5M8Y9
LinkDB
Position
Unknown
AA seq 160 aa
MTLEEVVACESAAQKMQTVSNAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEDEEDDIALQIHFTLIQAFCCDNDIDIVRVSGMRRLAELLGEPGPTEESEESRDLHCL
LVTNPHTDSWKSHGLVEVASYCEESRENNQWLPNISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccttggaagaagtcgtggcctgcgagagtgccgctcagaagatgcagacggttagc
aatgcagtggaggagctgctcgtagcggcgcagcgccaagaccgcctgacagtgggcgtg
tatgagtcggctaagctgatgaatgtggacccagacagcgtggtcctttgcctcttggct
atcgatgaggatgaggaggatgacatcgccttgcagatccatttcacgttgattcaagca
ttttgctgtgacaacgacatagatatagttcgggtgtctgggatgaggaggttggccgag
ctgctgggggagccggggcccacggaagagagcgaggagtcccgggatctgcactgcctg
ctggtcacgaatcctcatactgactcgtggaagagccatggactggtagaagtggctagc
tactgtgaggaaagccgagagaacaaccagtggctccccaacatctccctccaggagcgc
tga

DBGET integrated database retrieval system