KEGG   Phascolarctos cinereus (koala): 110197316
Entry
110197316         CDS       T05867                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110197316 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    110197316 (RARB)
   05222 Small cell lung cancer
    110197316 (RARB)
   05223 Non-small cell lung cancer
    110197316 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110197316 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcw03310]
    110197316 (RARB)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110197316 (RARB)
Nuclear receptors [BR:pcw03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   110197316 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110197316
NCBI-ProteinID: XP_020826757
UniProt: A0A6P5IXA1
LinkDB
Position
Unknown
AA seq 517 aa
MTIRINYRLLAVLSVIIHDSGLGKGPAAQRAKKGAELDGVGWTSPVPPASPPLEDKALLQ
TFSRERGETMFDCMDVLAVSPGQILDFYTASPSSCMLQEKALKACFSGLTQSEWQRRHTA
QSIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQK
NMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDKNKKKKEPSKQEFTESY
EMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEA
LKIYIRKRRPNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSE
GHEPLTPSSSGNTAEHSPSISPSSVENSGVGQSPLVQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgaccattcggatcaattacaggcttttagcggtgttgtctgtcataattcatgattcg
ggtctgggaaaaggaccagcagcccagcgtgccaagaaaggggcagagttggatggagtt
gggtggacttctcccgtgcctcctgcctctccacccctagaggataaagcacttttgcag
acattcagtagagagaggggagagaccatgtttgactgtatggatgttctcgcagtgagc
cctgggcaaatcctggacttctatactgcgagcccgtcttcttgcatgctccaggagaaa
gccctcaaagcatgcttcagtggattgacacaatccgagtggcagcgccggcacactgct
caatctatcgaaacacaaagcaccagttctgaggagctcgtccccagccccccttctcca
ctcccccctcctcgtgtttacaagccctgtttcgtatgccaggacaagtcgtcaggctat
cactatggcgtcagcgcttgtgagggatgtaagggcttcttccgcaggagtattcagaag
aacatgatttacacttgccatcgagataagaactgtgtgattaacaaagtcaccaggaac
cgctgccagtactgccgtctccagaagtgctttgaagtggggatgtccaaagagtctgtc
agaaatgataagaataagaagaagaaagagccttcgaagcaggaattcacagaaagctat
gaaatgacagcagaactggatgacctcactgaaaagatccggaaagctcaccaggaaacc
ttcccatccctctgccagctggggaaatacaccacgaactccagcgccgatcatcgggtg
cgcctggacctcggcctctgggacaagttcagtgagctggccacgaagtgcattatcaaa
atcgtggagtttgctaaaaggctgccgggcttcacgagtttgaccatcgcggatcagatc
accctcttgaaagcagcctgtctggacatcttgattcttagaatctgcacaagatacaca
cctgaacaagacacaatgaccttttccgatggccttaccctaaaccgaacccagatgcac
aatgccggctttggacctctcacagatctggtgttcacctttgccaatcagctcctgcct
ttggagatggatgacacagagacaggccttcttagtgccatctgtttaatctgtggagat
cgtcaggacctagaggaaccaacaaaagtggataagctacaagagccattgctggaagca
ctgaaaatttacatcagaaagagacggcccaacaagcctcacatgtttccaaagatccta
atgaagatcacagatctccgtagcattagtgcaaaaggtgcagaacgtgtgattacactg
aaaatggaaatccctggctcaatgccccctctcattcaggaaatgctggagaattctgaa
ggacatgaacccctgacaccaagttccagtggcaatacggcagagcacagtcctagcatc
tcacccagctccgtggagaacagtggggtcgggcagtccccactggtgcaataa

DBGET integrated database retrieval system