KEGG   Phascolarctos cinereus (koala): 110201716
Entry
110201716         CDS       T05867                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04145  Phagosome
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04514  Cell adhesion molecules
pcw04810  Regulation of actin cytoskeleton
pcw04919  Thyroid hormone signaling pathway
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110201716 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110201716 (ITGAV)
   04514 Cell adhesion molecules
    110201716 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110201716 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110201716 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110201716 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110201716 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110201716 (ITGAV)
   05205 Proteoglycans in cancer
    110201716 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110201716 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110201716 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    110201716 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110201716 (ITGAV)
   05414 Dilated cardiomyopathy
    110201716 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110201716 (ITGAV)
   05165 Human papillomavirus infection
    110201716 (ITGAV)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110201716 (ITGAV)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110201716 (ITGAV)
  Exosomal proteins of epithelial cells
   110201716 (ITGAV)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin alpha subunits
   110201716 (ITGAV)
CD molecules [BR:pcw04090]
 Proteins
  110201716 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 110201716
NCBI-ProteinID: XP_020833200
UniProt: A0A6P5JG48
LinkDB
Position
Unknown
AA seq 1063 aa
MAPWLGRRRRRRLPLLLLHLRRRCLHLLLPGLLLLLLPPLPPLCSAFNLDVDSPAEYSGP
EGSYFGFAVDFFAPDPSSMFLLVGAPKANTTQPGIVEGGQVLKCSWSSNRVCQPVEFDST
GNRDYAKNDPLEFKSHQWFGASVRAKQNKILACAPLYHWRTELKQEREPVGTCFLQDGTK
TVEYAPCRSRNIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKY
DPRVYSIKYNNQLATRTAQAVFDDSYLGYSVAVGDFNDDGIEDFVSGVPRAARTLGMVYI
YDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDNYADVFIGAPLFMDRGSDGKLQEVGQV
SICLQQASGGFQIVKLNGFEIFARFGSAIAPLGDLDQDGFNDVAIAAPYGGEDKRGIVYI
YNGRATGLNSVPSQILEGQWAARAMPPSFGYSLKGATDIDQNGYPDLIVGAFGVDRAVLY
RARPVITVNAGLEVYPTILNQDSKTCPLPGTDVKVSCFNVRFCLKADGKGRLPEKLNFQV
ELLLDKLKQKGAIRRALFLHNKSPGHSKNMSISKGGQMQCEELTAYLRDESEFRDKLTPI
TIFMEYRLDYKTAADVTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVHSDQK
KIYIGDDNPLTLIVNAQNLGEGAYEAELIVSIPPQADFIGGVRNSETLSRLSCAFKTENQ
TRQVVCDLGNPMKAGTKLLAGLRFSVHQQSEIDTSVKFDLQIQSSNLYDKVSPMVSYQVD
LAISAAVEIRGVSSPDHVFLPIPNWEHKENPQTEEDVGPVVQHIYELRNNGPSSFSKAML
NLQWPYKYNNNTLLYILHYEVDGPMNCTSDMEINPLKIKISTPQIDEKNETNLGQGDWSH
HITRRDLPPNEGDVHTLGCGTAECLKIVCQVGRLDRGKSVILYVKSLLWTETFMNKENQN
HSYSLKSSASFSVIEFPYKNLPIDDIHNSTLVTTNITWGIQPSPMPVPLWVIILAVLAGL
LLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGTSDA
NT seq 3192 nt   +upstreamnt  +downstreamnt
atggccccttggctggggaggaggcggcggcggcggctgccgctactgcttctccacctc
cggcgccgctgcctccacctccttctcccgggcctcctgctgctactgctgccgcccctg
ccacctctctgcagcgccttcaacctggatgtggatagtcccgccgagtattctggcccg
gagggaagttacttcggctttgcggtggatttcttcgccccagacccttcctcgatgttc
cttctggttggagctcccaaagcaaacactacccaacctggcattgtagaaggaggacaa
gtgctcaagtgcagctggtcttctaatcgtgtatgccagccagtggaatttgactcaaca
ggcaatagagattatgccaagaatgatccattggagtttaagtctcaccagtggtttgga
gcttccgtgagagctaaacagaataaaattttggcctgtgctccattgtatcattggagg
actgaactgaaacaagagagagaacctgttggaacatgctttctacaagatggaacaaag
actgttgagtatgctccctgccggtcaagaaatattgatgctgatggacagggattttgt
caaggaggattcagcattgattttacaaaggcagacagagtacttctgggaggtcctggc
agtttttattggcaaggtcagctcatttctgatcaagtggcagaaattgtgtctaaatat
gacccccgtgtatacagcatcaaatataataaccaattagcaactcggacagctcaggct
gtttttgatgacagctacctaggctactccgtggctgttggggacttcaatgatgatggt
atagaagactttgtttctggagtcccgagagctgcaaggacattgggaatggtttatatt
tatgatggaaaaaatatgtcttctttgtataattttactggagaacagatggctgcatat
tttggattttctgtagctgccactgacattaatggggataattatgcagatgtgtttatt
ggagctcctctcttcatggatcgtgggtctgatggcaaacttcaggaagtgggtcaggtc
tccatatgcctgcagcaagcttcaggaggttttcagatcgtaaagctgaatggctttgag
atctttgccagatttggtagtgctattgcccctctgggagatcttgaccaggatggcttc
aatgatgttgcgattgctgccccctatgggggagaggacaaacgagggattgtttatatc
tacaatggaagagccacaggcttaaattcagtgccatctcaaatcctagaaggacagtgg
gctgcccgggctatgccaccaagctttgggtactcattgaaaggagccacagatatagat
caaaatggatacccagatttaatcgtgggtgcttttggtgtggaccgagctgttttatat
agagccaggccagttatcactgtaaatgcaggcctagaagtttaccccactattctaaat
caagatagtaagacctgtccactccctggcacagatgtcaaagtttcctgctttaacgtg
agattctgcttaaaggctgatggcaaagggaggcttccggagaagctgaatttccaggtt
gaacttcttttagataaactgaagcaaaaaggagccattaggagagccctctttctccat
aacaaatcacctggacactcaaagaacatgagtatttcaaagggtggtcagatgcaatgt
gaggagcttacagcatatctacgggatgaatctgaatttagagataagctcactccgatt
accatttttatggagtaccgtttagattacaagactgcagctgatgtaactggattgcaa
cccattcttaaccagtttactcctgccaatattagtcgacaggctcacattctactggac
tgtggtgaagacaatgtctgcaaacccaaactggaagtttctgtacatagtgatcaaaag
aagatatatatcggcgatgacaaccctctgacgctgattgttaatgcccagaatctaggg
gaaggagcgtatgaggctgagctcattgtgtccattccaccccaggcagatttcattggt
ggtgtccgtaacagtgaaactttatcaaggctgtcctgtgcatttaagacagagaatcaa
acacgccaggtggtatgtgaccttggaaatcccatgaaggctggaactaaacttttagct
ggtcttcgtttcagtgtgcaccaacagtcagagatagatacttctgtgaagtttgattta
cagatccagagctctaatctgtatgacaaagtgagtccaatggtatcttaccaagttgac
cttgccatttctgctgctgttgagataagaggagtctcaagccctgatcatgtcttcctt
cctattccaaactgggagcataaggagaatccacagactgaagaggatgttgggcctgtt
gtacaacacatttatgagctgagaaacaatggtccaagttcattcagcaaggcgatgcta
aaccttcagtggccttacaagtataacaacaatactttgctatatatccttcattatgaa
gttgatggaccaatgaactgtacttcagatatggagattaacccattgaaaattaagatt
tcaactcctcagatagatgaaaaaaatgaaacaaacttaggacaaggtgactggagtcat
cacatcactaggcgggatttacctcccaatgaaggggatgtacacactttgggatgtggg
actgctgaatgcttgaagattgtctgtcaggttggtcgccttgacaggggaaagagtgtg
atcctatatgtaaagtctctgctgtggactgagactttcatgaataaggaaaatcagaat
cattcatactcactgaagtcatcagcttcattcagtgtcatagaatttccctacaagaac
ctccctatcgatgacatccacaactctacattagttaccactaatattacctggggtatt
cagccatcacccatgccagtgcctttgtgggtgatcattttagcagttcttgctggatta
ttgttattggctgtcctggtctttgtaatgtacaggatggggttttttaaacgggtcagg
ccacctcaggaagaacaagaaagagaacagcttcaacctcatgaaaatggtgaagggact
tcagatgcataa

KEGG   Phascolarctos cinereus (koala): 110211575
Entry
110211575         CDS       T05867                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04514  Cell adhesion molecules
pcw04640  Hematopoietic cell lineage
pcw04810  Regulation of actin cytoskeleton
pcw05145  Toxoplasmosis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110211575 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110211575 (ITGA6)
   04514 Cell adhesion molecules
    110211575 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110211575 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110211575 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110211575 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211575 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110211575 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110211575 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110211575 (ITGA6)
   05414 Dilated cardiomyopathy
    110211575 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110211575 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110211575 (ITGA6)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110211575 (ITGA6)
  Exosomal proteins of breast milk
   110211575 (ITGA6)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin alpha subunits
   110211575 (ITGA6)
CD molecules [BR:pcw04090]
 Proteins
  110211575 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Other DBs
NCBI-GeneID: 110211575
NCBI-ProteinID: XP_020846629
UniProt: A0A6P5KP01
LinkDB
Position
Unknown
AA seq 1093 aa
MAAEGQPELLFYLSACLLLYFCAAFNLDTREENVIRKTGEPDSLFGFSLAMHWQLQPQDK
RLLLVGAPRARAFPLQKANRTGGLYSCDITSQEPCQRIEFDNDADPNSESKEDQWMGVTV
QSQGPGGKVVTCAHRYERRQHVNTKQESRDIIGRCYVLSQSLTIEDDMDGGDWSFCDGRL
RGHEKFGSCQQGVSATFTKDFHYIVFGAPGTYNWKGIVRAEQKNNTFFDMNIFEDGPYEV
GGETDHDESLVPVPANSYLGFSLDSGKSIVSKDDITFVSGAPRANHSGAVVLLKRDMKSA
HLFTEYLFEGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYINQQG
KWNNVKPIRLNGTKDSMFGIAVENIGDVNQDGYPDIAVGAPYDDLGKVFIYHGSPSGINT
KPTQVLEGKSQYFGYSIAGNMDLDKNSYPDVAVGSLSDSVSVFRSRPVINILKTITVTPN
RIDLRQKMNCDAPSGICLKVKACFEYTAKPSNYNPAISIVGTLEAESQRRKSGLSSRVHF
PNQASEPKSSHALTLKAQKQKMCMDRTLWLQENIRDKLRPIPITASVEIQEPSSRRRANS
LPELLPILNSNEPKTVTSEVQFLKEGCGNDNICNSNLKLEYRFCTRDGNQDKFSYLPIHN
GIPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAY
PEKQLSCAANVNGSQVDCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDVNLKLETTSNQ
DNLASITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGERAMKSEDEIGNLIEYEFRVINL
GKPLKNLGTASLNIQWPKEISNGKWLLYLMKIESKGLEQINCEPQDEINSLGLKESPHNS
RKKREIAEKQTDDGRKFSLFAERKYQTLNCSTNVNCVNIKCPLHGLDSKASVILRSRLWN
GTFLEEYSKLNYLDILLQASINVTAVAENIKVPNAGTQVRVTVFPSKTVAQYSGVPWWVI
LVAILAGILMLALLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEERQIRDEKYNDGLEKK
QWITKWNEDESYS
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggcggctgaagggcagccggagctcctcttctacctgtcggcgtgcctgctgctctat
ttctgcgccgcctttaacttggacactcgggaggaaaacgtgatccgcaagaccggggag
cctgacagtcttttcggattctccctggccatgcattggcagctgcagccgcaggacaag
aggctgttgttggtaggggccccccgagccagagcttttccactgcagaaggctaaccgg
acaggaggcctgtacagctgtgacatcacatcccaggaaccttgccaacgcattgaattt
gataatgatgctgaccctaattctgagagtaaggaagaccaatggatgggtgtcactgtc
cagagtcagggaccagggggaaaggtggtgacgtgtgcccatcggtatgagagaaggcaa
cacgttaataccaagcaggagtcgcgggacataattgggaggtgctatgtgttaagtcag
tctcttaccattgaagacgacatggatggaggagattggagtttttgtgatggccgtttg
agaggccatgagaaatttggttcctgtcagcaaggtgtatctgcaacttttactaaagat
ttccattacattgtttttggagccccgggcacttacaattggaaaggaattgttcgtgca
gagcaaaagaataacactttttttgacatgaatatctttgaagatgggccatatgaagtt
ggtggtgagactgaccacgatgagagtctagttcctgttccagctaacagttatttaggt
ttttcactggactcaggaaaaagtattgtctctaaagatgatatcacttttgtgtctggt
gcaccaagagccaaccatagtggagctgtggttctcctaaagagagacatgaaatctgcc
catctttttactgagtatctgtttgaaggagaagggctggcctcttcatttggctatgat
gtggcagtagtggacctcaacaaagatggctggcaagatatagttattggagcaccacag
tattttgatagagatggagaagttgggggtgctgtgtatgtctacattaatcagcaaggc
aaatggaataatgtcaagccaattcgccttaatggaaccaaagattctatgtttggcatt
gcagtggaaaacatcggtgatgttaatcaagatggatacccagatattgcagttggagca
ccttatgatgatttggggaaggtttttatctatcatggctctccaagtggaataaataca
aaaccaacacaggttcttgagggtaaatctcaatactttggctactcaattgctggaaat
atggaccttgataaaaattcctatcctgatgttgccgttggttcgctctcagattcagtg
tcagttttcagatctcgacctgtgatcaatatcctgaaaacaatcacagtaacaccgaac
agaattgacctaagacagaaaatgaactgcgatgcgccgagtggaatatgcctgaaggtt
aaggcctgttttgaatacactgccaagcccagtaattacaatcctgcaatatcaattgtg
ggcacacttgaagctgaaagtcagaggaggaaatccggcttatcatcaagagttcatttt
ccaaatcaagcttctgagcctaagtcttcccatgccttgactctgaaagcgcagaaacaa
aaaatgtgcatggacagaacactttggctgcaggagaacatcagagataaactgcgtccc
attcccataacagcatcagtggaaatccaagaaccaagttcacggaggcgagcaaattca
cttccagaacttcttccaattttgaattcaaatgaacccaaaacagtcacctcagaggtc
cagttcttaaaagagggatgcggaaatgataacatctgtaatagcaatctgaaattagag
tacagattttgtacgcgagatggcaaccaagacaaattttcttatttaccaattcacaat
ggcataccagagcttgttctcaaagaccagaaggatattgctttagaaataacagtgaca
aatagcccttccaatcccaggaatcctaccaaagatggagatgatgcccatgaagccaaa
cttattgcaacttttcctgataccttaacttattctgcatacagagagctgagggcttat
cctgaaaaacaattgagttgtgcagccaacgtaaatggttcccaagtagattgtgaactt
ggaaatccctttaagagaaattccagtgttactttttatttgattttaagtacaacagaa
gtcacctttgataccacagacctggacgtgaatctgaagttagaaacaacaagcaatcaa
gataatttggcttcaattacagctaaagctaaagtggttattgaactgcttttgtcggtc
tctggagttgctaaaccttcccaggtgtactttggaggtactgttgttggtgagagagct
atgaaatctgaagatgaaattggaaacttaatagaatatgaattcagggtaattaattta
ggtaaacctcttaaaaatcttggcacagcatctctaaacattcagtggcccaaagaaatt
agcaatggcaaatggctgctttatttgatgaaaatagaatccaaagggttggaacaaata
aactgtgagccacaagatgaaattaactctctgggactaaaggaatctcctcacaactct
agaaagaaacgagaaattgcagagaaacagacagatgatggcagaaaattttctttattt
gcagaaagaaaatatcagacacttaactgtagcacaaatgttaactgtgtgaacataaaa
tgtcccctacacggtttggacagtaaagcttctgttatattacggtcaagactgtggaac
ggtacattcctagaggaatattccaagctgaactacttagatattcttcttcaggcttcc
attaatgttactgctgttgcagagaatattaaggttccaaatgcaggcactcaagtccgt
gtcacagtattcccttcaaagacagtcgcgcagtattctggagtgccatggtgggtcatc
cttgtggctattcttgctggaattctgatgcttgctctattagtattcttactatggaag
tgtggattctttaagcgctccaggtacgatgacagtgttccccgataccatgctgtaaga
atccggaaggaggaacgacagatcagagatgagaaatataatgatggcctggaaaaaaaa
cagtggatcacaaaatggaatgaagatgaaagctactcctag

KEGG   Phascolarctos cinereus (koala): 110215432
Entry
110215432         CDS       T05867                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2 isoform X1
  KO
K06481  integrin alpha 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04145  Phagosome
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04611  Platelet activation
pcw04640  Hematopoietic cell lineage
pcw04810  Regulation of actin cytoskeleton
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110215432 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110215432 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110215432 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110215432 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110215432 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110215432 (ITGA2)
   04611 Platelet activation
    110215432 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110215432 (ITGA2)
   05205 Proteoglycans in cancer
    110215432 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110215432 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110215432 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110215432 (ITGA2)
   05414 Dilated cardiomyopathy
    110215432 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110215432 (ITGA2)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110215432 (ITGA2)
  Exosomal proteins of bladder cancer cells
   110215432 (ITGA2)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin alpha subunits
   110215432 (ITGA2)
CD molecules [BR:pcw04090]
 Proteins
  110215432 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Arch_flagellin Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 110215432
NCBI-ProteinID: XP_020852522
UniProt: A0A6P5L413
LinkDB
Position
Unknown
AA seq 1174 aa
MGEVRNWGALMLLSQVLPYCAAYNIGLLEAKIFDGPSTEQFGYAVQQFVNTNGNWLLVGS
PWSGFPENRMGDIYKCPVNLPSTMCEKLNLQTVTSIPNVTEIKTNMSLGLTLTRNLGTGG
FLTCGPLWAQQCGNQYYATGICSDVSPSFQLLNSFSPAVQSCPSFIDVVVVCDESNSIYP
WSAVKNFLVKFVQGLDIGPDKTQVGLIQYGNYPRVVFNMSTFKTKEEMVKATSQTTQHGG
DLTNTFKAIQFARDFAYSEASGGRPSATKVMVVVTDGESHDGSMLKKVIGQCNDDNILRF
GIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVSDEDALLEKAGTLGERIFSIEGT
VQGGDNFQMEMSQVGFSADYSPQNGALALGAVGAYAWSGTVVQQTPHGYSIFPRQAFEKV
LQDRNHSSYLGYSVAVISNGNSVHFVAGAPRADYTGQVVMYSVDADGNATIIQSHRGDQI
GSYFGSVVCSVDVNRDTITDVLLVGAPMFMNDLKKEEGRVYLFTITKGILNQHRFLEGPP
GLENARFGSAIAALSDINLDGFNDVVVGSPLENENSGAVYIYNGHQGTIRTKYSQKILGS
DPAFRNQLQYFGRAVDGYEDLNGDSITDISIGAFGKVVQLWSQSIADVSIEASFTPEKIN
LLNKNAEITLRLCFSAKFRPTTQNSQVDIIYNITLDADRFSSRITSRGLFKENNERYVKK
NVVVYHTHTCSEHIINIQEPSDVVNSLNVRVDISLAKPGTSPALEEYSETSKDFSIPFLK
DCGDDGVCISDLVLKVQQITDTQKQPYIVSSQNRRLTFAVMLKNKGESAYNTRIVAAFSE
NLFFASSSASVDGTEVSCQLDTSKKVLTCNVGYPSVKSDQQVSFNINFDFNFQNLQNLAR
VSFQALSESQEEKEEDNTVNFKIPLLYDAEIHLTRSTNINFYEVFSHGNVSSTVKTLHEI
GPMFSFSVKITTGSIPVSMASVTISIPQYTKENNALMYLTGIHVAQDSDISCTAKINPLK
IGETPYSVSFKKENFRDIKELNCKTASCSKVTCQLRELEMKEEYFVNVSTRIWNGTFAAS
SFQTIQLVATAEVDPFDPQIYIIEENTVMIPVTIMKPDEKAEIPIGVIIGSIIAGLLLLL
ALTTVLWKLGFFKRKYEKMAKNPDEIDETADLNS
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgggggaagtcagaaactggggcgctctgatgcttctcagtcaagtccttccttattgt
gctgcatataacattggtctcctggaagcaaaaatatttgatggtccttcaaccgagcaa
tttggatatgcagtacaacagtttgtaaataccaacggcaactggttgcttgttggctca
ccatggagtggttttccagagaacagaatgggagatatctacaaatgtcctgtcaactta
cccagcaccatgtgtgaaaaactgaatttacaaactgtaacgagcattccaaatgttacc
gagataaaaacaaatatgagtcttggcttgacactcacacggaacttgggaactggaggg
tttctgacatgtggacccctgtgggcccagcagtgtggaaatcagtattatgcgactggc
atctgttctgacgttagtcccagtttccagctcctcaacagcttttcacctgcagttcag
agctgcccatccttcattgatgttgtggttgtatgtgatgaatcaaacagcatttatccc
tggagtgcagtgaagaattttttggtcaaatttgtgcaaggcctggatataggtcccgac
aagacccaggtggggctaattcagtatggaaattatccacgagttgtattcaacatgagt
acttttaaaacaaaagaagaaatggttaaagcaacatcccaaacaacccagcatggtgga
gatctcactaatactttcaaagcaattcaatttgccagagattttgcttattctgaagcc
tctggtggacgacctagtgctaccaaagttatggtggttgtgacagatggtgaatctcat
gatggctcaatgttgaaaaaagttattggtcaatgcaatgacgacaacatacttagattc
ggcatagcagtgcttggatacttaaatagaaatgcacttgacacaaaaaatttaataaaa
gagatcaaagcaattgctagtactccaacagagagatattttttcaatgtttctgatgaa
gatgcactcttggaaaaggctgggacattgggagagcgtattttcagcattgaaggtact
gttcaaggaggtgataactttcaaatggaaatgtcacaagtggggttcagtgcagattac
tctcctcaaaatggtgctctggcactgggtgcagtaggggcatatgcctggagtggaaca
gtagtccagcagacaccccatggatattccatcttccccagacaagcctttgaaaaagtt
ctgcaagacagaaaccacagttcatatttaggatattctgttgcagttatttctaatggt
aacagtgtccattttgttgcgggtgctccccgggcagattatacgggccaagtagtaatg
tatagtgttgatgctgatggtaatgccacaatcattcagtctcacagaggtgaccagatt
ggctcctattttggcagtgtggtgtgttctgttgacgtaaatagagatactattacagat
gtgcttttggtgggggcaccaatgttcatgaatgaccttaagaaagaggaaggaagggtc
tacctgttcactatcacaaagggaattttgaatcagcatcgattccttgaaggccctcca
ggtttggagaatgcccggtttggctcagcgattgccgctctatcagacattaatttggat
ggtttcaatgatgttgtagtgggctcaccccttgaaaatgagaactctggagctgtttac
atttacaatgggcatcaggggaccatacgaacaaaatactctcagaaaatattagggtca
gatcctgcctttaggaatcagctccagtattttgggagagcagtagatggctatgaagat
ctgaatggagattcaatcactgacatatccattggtgcctttggaaaagtggttcagctc
tggtcacagagtattgctgatgtctccatagaagcttcatttacccctgaaaagatcaat
ttgttaaacaagaatgctgaaataaccctcagattgtgcttcagtgcaaaattcagacct
accacacaaaacagtcaagtggatattatctacaatataacacttgatgctgatcgattt
tcctctagaataacttctaggggattatttaaagaaaacaatgaaagatacgttaagaaa
aacgtggtggtgtatcatacacatacttgttcagagcacatcatcaatatacaggaacct
tctgatgttgtcaactccttaaatgtccgagtggacatcagtttggcaaagcccggtacg
agtcctgctcttgaagagtattctgagacttcaaaggacttcagtataccttttttaaaa
gactgtggggatgatggagtctgcatctctgatcttgtccttaaagttcaacagataacg
gatactcaaaaacagccatatattgtcagcagccaaaatagaaggttaacatttgcagtg
atgctgaaaaataaaggagaaagcgcttataacaccagaattgtggctgctttctcagaa
aacttgttttttgcctcgtcctcggcatcggttgacgggactgaggtttcatgtcagttg
gatacttccaagaaggttctcacctgtaatgttggctatccttctgtcaagagtgaccag
caggtgtcttttaacataaacttcgacttcaatttccaaaatcttcaaaacttggcacgt
gtcagttttcaagctttaagtgagagtcaagaagagaaggaggaggacaatacagtcaac
ttcaaaattcctttgctgtatgatgcagaaatccatttaacaaggtctaccaacatcaat
ttttatgaagtcttttctcatggcaatgtttcctccacggtgaagactctccatgagatt
ggccccatgttcagcttttcagttaagatcacaacaggaagcattccagtatccatggct
tctgtaaccatctcgattcctcaatacaccaaagaaaataatgcattgatgtacttgaca
ggaatacatgtagcccaggacagtgatatcagctgcactgcaaaaataaatccactaaaa
ataggagaaacaccttactcagtgtcttttaagaaagaaaacttccgagatattaaagaa
ttgaactgcaaaactgcctcgtgtagtaaagtcacctgccagctaagagaactggaaatg
aaagaagaatactttgtaaatgtgtctaccaggatctggaatgggacttttgcagcgtca
tctttccagacaattcagctggtagcaactgcagaagtggacccatttgacccacaaata
tatataattgaagaaaacactgttatgattccagttacaataatgaagcctgatgaaaaa
gctgaaataccaataggagttatcattggaagtataatcgctgggcttctcttgctgtta
gccctaactactgttttgtggaagcttggctttttcaagaggaaatatgagaaaatggcc
aaaaatccagatgaaattgatgagactgcagacctaaacagctga

KEGG   Phascolarctos cinereus (koala): 110215841
Entry
110215841         CDS       T05867                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04640  Hematopoietic cell lineage
pcw04810  Regulation of actin cytoskeleton
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110215841 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110215841 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110215841 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110215841 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110215841 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110215841 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110215841 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110215841 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110215841 (ITGA3)
   05414 Dilated cardiomyopathy
    110215841 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110215841 (ITGA3)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110215841 (ITGA3)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin alpha subunits
   110215841 (ITGA3)
CD molecules [BR:pcw04090]
 Proteins
  110215841 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N
Other DBs
NCBI-GeneID: 110215841
NCBI-ProteinID: XP_020853303
UniProt: A0A6P5L5B6
LinkDB
Position
Unknown
AA seq 1051 aa
MDPGPRVRRASCGQRLPLCALALALAAAGCRVASAFNLDTRFLVVKEASNPGSLFGYSVA
LHRQTEQQQRYLLLAGAPRDLAIPDGHTNRTGAVYLCPLSSQTDDCERMYIEEKSDPGQH
IIEDMWLGVTVASQGPAGRVLVCAHRYTKVLWSGSEDQRRMVGKCYVRGNDLQLDSRDDW
QTYHNEMCNSNTDYLGTGMCQMGTSGGFTHNTVYFGAPGAYNWKGTTYMIQRKDWDFSEH
SYTNTEDLGHLYIGYAVQVGSGILHPESLTIVAGAPRHRHVGSVFLMNVEAGGEIEMKQV
LEGEQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEIGGAVYIFMNQGGIFPIHPS
QHLHGPSGSNFGFSVASLGDINQDGFQDVAVGAPFEGLGKVYIYHSSASGISDRPQQVIH
GEKLGTPGLATFGYSLSGRLDVDENSYPDLLVGSLADRIVLLRARPVINILNKTLAVRPT
MLDPTRCTSTSCIQVEVCFAYNQSAGNPSYRQNITLAYTLEADRDRRPPRVRFAKSPSSV
YHGLFSMPDTRCQTLDLLLVDSIRDKLRPISIFMNYSLPEKLPEHPRLGLHSLDAFPVLN
EAQPRENQTEIQFQKECGTDNKCDSNLQLQAAFLSERLQPINRLQYSKDVRKLYLNVNIT
NVPSRHRAGEDAHEALLTLVLFPALLISSIRPAGACQVNETIVCELGNPFKRNQKMELSI
AFEVVGITLQTQDIEAQLQLSTSSHQDNLKPVTLMLQVDYALQASLSMVNHRLQSYFGGT
VMGESGMKNVTDVGSPITLEFQVGPMDEGLAALGTLVLGLEWPYEVSNGKWLLYPTEIII
QGNGTRHCQPPGNLINPLNLTISRDEAPFHRRWRRELDPGESQAPPPITLATSKKAESET
LLSCANGRAHCVWLECQIPDVSVPSTMTVQARVWNSTFIEDYSDFDRVRVEGWATLFLRT
DILTISMENKTTWFSVDIDSELTEELPAEIELWLILVSVGAGLLLLGLIILLLWKCGFFK
RASTRALYEAKGQKAEMKSQPSETERLTDDY
NT seq 3156 nt   +upstreamnt  +downstreamnt
atggacccaggcccccgcgtccgccgtgcctcttgtggccagcgcctgcccctctgcgcc
ttggcgctggcgctggcagctgcgggctgtcgcgtagcctccgccttcaacctggacacc
cggttcctggtggtgaaggaggcctcgaaccctgggagcctcttcggctactccgtcgcc
ctccaccggcagactgagcagcagcagcgctacctactccttgctggtgctccacgggac
cttgctatacctgatggccacaccaaccggacaggtgcagtgtacctgtgccccctcagc
tcccagacagatgactgtgaacggatgtatatagaggaaaaaagtgatcccgggcagcac
attattgaggacatgtggcttggggtgacagtggccagccagggaccggcaggcagagtg
ttggtctgcgcccatcgctacaccaaggtgctgtggtcagggtcagaggaccagcggcgg
atggtgggcaagtgttatgtgcggggcaacgatctacaactcgactccagagacgactgg
cagacgtaccacaatgagatgtgcaacagcaacacagactacctgggcacaggcatgtgc
cagatgggcaccagtgggggcttcacccacaacactgtgtattttggggcacctggtgcc
tacaactggaaaggtaccacctatatgatccagaggaaagattgggatttttcagagcac
agttatacaaacacagaggacctagggcatctctatatcgggtatgcagtacaggtgggg
agtggcatcttgcaccctgaaagtctcaccattgtggctggtgctccccggcaccgccac
gtgggctctgtcttcctcatgaacgtggaggcaggtggggaaattgagatgaagcaggtg
ttggaaggggagcaggtgggtgcctacttcggcagcgccatcgccctggcggaccttaac
aatgacgggtggcaggatctcctggtgggtgccccctactactttgagcggaaggaagag
atcggtggtgcagtctacatttttatgaatcaggggggcatcttccccattcacccttcc
caacacctccatgggccaagtggctcaaactttggcttctctgtggccagccttggagac
atcaaccaggacggcttccaggacgttgcagtaggtgctccatttgagggtttgggcaaa
gtctacatctaccacagcagcgcctcaggcatcagcgaccgacctcagcaggtgattcat
ggggaaaagcttggcacccctggcctggccacctttggctactcgctgagtgggcggctc
gacgtggatgagaactcataccccgacctgctggtggggagtctggctgaccgcatcgtg
ctgttgcgagcccgtccagttatcaacatccttaacaagactctggcagtgaggcctacc
atgctggatcctactcgctgtacttctacctcctgcattcaggtcgaggtgtgcttcgcc
tacaaccaaagtgcagggaatccaagctacagacaaaacatcaccctggcatataccctg
gaggcagatcgagatcgacgcccaccccgagtccggtttgctaagagtccttcttctgtt
taccatggattgttttccatgcctgacacccgctgccaaacccttgatctgcttctggtg
gacagtattcgggataagctccgccctatctccatcttcatgaactactccttaccagag
aagcttcctgagcacccgcgcctgggactccattccctggatgcctttcctgtccttaat
gaggcccagcccagagagaaccaaacggagattcagttccagaaggagtgtggtactgac
aacaagtgtgacagtaacttacagcttcaggctgccttcttgtctgaacggctacagccc
attaacagactccagtacagtaaggatgtccggaagctgtacctgaatgtcaacataacc
aacgtgcccagcaggcaccgagctggggaggacgcccatgaggccttgctcaccttagtt
ttgtttccagccttacttatctcttctatccgccctgctggagcctgccaggtcaatgag
actatcgtgtgtgagctgggaaacccttttaagaggaaccagaagatggagctgtctatt
gccttcgaggtcgtgggtatcactctgcagactcaggacatcgaggctcagttgcagctt
tccacgtccagtcaccaggataacctaaagcctgtgaccttgatgctacaggttgattat
gcactccaggcctcactcagcatggtgaatcaccggctacagagttactttggaggaaca
gtgatgggagagtcaggcatgaaaaatgtcactgatgtcgggagccctatcaccttggaa
ttccaggtgggcccaatggatgaggggctggcagctttgggaactctggtcctggggctg
gaatggccctatgaagttagtaatggcaaatggcttctgtaccccaccgagatcatcatc
cagggcaatggaacccggcactgccagccacctgggaaccttatcaatcctctcaacctc
actatttctagagatgaagccccttttcatcgacgatggcgaagggagttggatcctgga
gaatcacaggcacctcctcctattaccctggccacttccaagaaggcagagtcagagact
ctgttgtcctgtgccaatggtcgagctcactgtgtgtggcttgagtgccagattcctgat
gtctcagtaccctctaccatgacggtgcaggcacgagtgtggaacagcaccttcattgag
gattacagtgattttgacagggtcagggtggaaggctgggccacactcttccttcgaacc
gacatcctgaccatcagtatggagaacaagacgacatggttttctgtggacattgactca
gagctgaccgaagagctccctgctgagattgagctttggctgatcctagtatctgtggga
gctgggctgttactgttggggctcatcatcctcttgctttggaagtgtggcttcttcaaa
cgagctagcactcgggccctgtatgaagccaaagggcaaaaggcggagatgaagagccag
ccttctgagacggagaggctgaccgatgactactga

KEGG   Phascolarctos cinereus (koala): 110215866
Entry
110215866         CDS       T05867                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb isoform X1
  KO
K06476  integrin alpha 2B
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04015  Rap1 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04611  Platelet activation
pcw04640  Hematopoietic cell lineage
pcw04810  Regulation of actin cytoskeleton
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110215866 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    110215866 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110215866 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110215866 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110215866 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110215866 (ITGA2B)
   04611 Platelet activation
    110215866 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110215866 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110215866 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110215866 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    110215866 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110215866 (ITGA2B)
   05414 Dilated cardiomyopathy
    110215866 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110215866 (ITGA2B)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110215866 (ITGA2B)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110215866 (ITGA2B)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin alpha subunits
   110215866 (ITGA2B)
CD molecules [BR:pcw04090]
 Proteins
  110215866 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 110215866
NCBI-ProteinID: XP_020853356
UniProt: A0A6P5LCS8
LinkDB
Position
Unknown
AA seq 1053 aa
MVRTQCLLPVLWLLRWIQLLLVPGGVPPAWALNLDAAQPALYVGPNGSYFGFALDFYQDG
YGGIGIAVGAPRALSPEGEETGGVFLCPWATQGTTCSPLTFDLKDQTSRVGAITFKTFKT
KQGLGASVVSWKDNIVACAPWQHWNALELTEEAGKTPVGNCFVAHPKSGRRAEYAPCREN
AMNPLYLGNYGYRRDLRYCEIGFSSTITQSGELVLGAPGGYYFIGLLARAQLSDIMSSYT
PSSLLWTVPSQRLTKDVFTSEHRDAYRGYSVAVGEFNENPKDTEYVLGTPNWSTTLGAVE
IFYQNLSVLHVLQGEQVASYFGHTVAVTDINRDGRDDLLVGAPLFMEHRANRKMAEVGRV
YIYLQQRTQQILGNPRHLTGTELYGRFGSAIAPVGDLDQDGYNDIAVGAPFGGPSGQGRV
FIFRGQDEGLSPRPSQVLDSPFHQGFGFGFALKGAADIDANGYPDLLVGAFGASQVAVYR
AQPVVLATVRLLVPEVLNPAVKNCEPPNPKTTVAVSCFNIQICMSITGHNIPEKLRINAE
LQLDRLKPRQGRRVLFLSSLQSSTTLELELASGHVPVCHDAKAFLRDETEFRDKLSPIVL
GLNVSLKNEGARGPLPLVLNGDTHVQEQTRIILDCGEDDLCVPQLQLTASMKGSPLFIGA
DNVLEMQVSASNEGEGAYEAELAVHLPRGAHFMQALSDVKNFEKLLCIQKKENESQLVLC
ELGNPMKKDARMRILMLVSVGNLEEAGDSVSFMLQIKSKNSQNPNSEAFRLEVPVRAKAH
VELFGNSFPASVVLSPPPEGTLGNEDPITVDRSTYKMEDISKVEHAFELHNQGPGTVTGL
RLQIGFPSHSQTDDLLYVLDVQAQGGLQCSAQPPPNPLNLKVGQPTPAPSSAPTHPFQHE
REKRNVFIPEHLEPSELQEPIVLNCDTWPCTWVECELKQMERGQRSMVTISTILWPPGLF
KRPLEQFVLKSEAWFNVSGLPYDVPVESLPHGNVMVQTNLLRVLLEEREIPTWWVVVGVM
GGLLLLALLILVMWKVGFFKRNRPPLEEEEEEE
NT seq 3162 nt   +upstreamnt  +downstreamnt
atggttagaactcagtgcctgctgcctgttctgtggctcttgagatggatacagctgctt
ctggtgcctggtggtgttccccctgcctgggccttgaatctggatgctgcacagccagcc
ctctatgtgggccctaatggcagctactttggatttgctttggatttctaccaggatggt
tatggcggcattggcatcgctgtgggagccccacgggctttaagtcccgagggggaggag
actggaggtgtgttcctatgtccttgggcgacccaggggactacctgcagccccctgacc
tttgacctcaaggatcagaccagcagggtgggtgccatcaccttcaaaaccttcaagacc
aagcagggacttggtgcatccgtcgtcagttggaaggacaacattgtggcctgcgctccc
tggcagcattggaacgcgctggagctgaccgaggaggccggaaagacacccgtcgggaac
tgcttcgtggcccaccctaagagtggccgtcgggcagagtatgcaccgtgccgggagaat
gccatgaacccgctctacctggggaactacggctaccgcagagacttgcgctactgcgaa
atagggttcagttccacgatcacccagtctggggagctggttctgggggctcctggaggc
tactatttcataggtctgctagctagggctcagctttctgacatcatgtccagctatacc
ccatcctcactcctctggaccgtgccctcccagcgcctgactaaggacgtctttacgtct
gaacaccgggatgcctaccgggggtactcggtggctgtgggagagtttaatgaaaaccct
aaagatacagaatatgtactgggtacccccaactggagcacaacgctgggagcggtggag
attttttaccagaacctcagcgtcctgcatgttcttcaaggagagcaggttgcatcatac
tttgggcacacagtggccgtgactgacatcaacagggatgggagagatgacttgctggta
ggtgccccactcttcatggaacatcgagccaaccgaaagatggcagaagtaggacgggta
tacatctacctgcagcagcgaacccaacagatcctgggcaaccccaggcatctgactggc
acagagttatatgggcgttttggctcagccattgctcctgttggtgatctggaccaggat
gggtacaatgatatagccgtaggtgcgccatttggaggccccagtggacagggccgagtg
tttatattccggggacaggatgagggcctgagcccacgcccatcgcaagttctagatagc
cctttccaccaaggttttggatttggctttgccctgaaaggggccgccgacattgatgct
aatggatacccagacctgctggtgggggcatttggagccagccaagtggccgtatacagg
gcccagcccgtggtgttggctactgtccgattactggtgccagaagtgctgaacccagct
gtgaagaactgtgaacctcccaacccaaagaccaccgttgcagtcagctgtttcaatatc
cagatatgtatgagcatcactggtcacaacatcccggagaagcttcgtataaatgctgag
ctacagctggaccggttgaaaccacgacagggtcggcgggtgctgttcttgagttctctg
caatcaagcaccactctagaattagaactagccagtggacatgtccctgtctgccatgat
gccaaggccttcttgcgggatgagactgaattccgggacaagctgagccccatcgtgctc
ggccttaatgtgtccctaaagaacgagggggctagaggccccctgcccctcgtactgaat
ggagacactcatgtacaggagcagactcgcatcatactggactgtggggaagatgaccta
tgcgtgcctcagttacaacttactgccagcatgaaaggttctccactcttcattggggca
gacaatgtgctagagatgcaagtgagtgcctccaatgaaggtgagggtgcctatgaggct
gagctggcagtccatctgccccgaggcgcccatttcatgcaggccctgagtgacgtcaag
aactttgagaaactactttgcatccagaagaaggagaatgagagtcagttagtgttgtgt
gaactgggcaaccccatgaagaaggatgccaggatgagaatcctgatgctggtgagtgtg
ggaaacctggaggaagctggggacagtgtctcctttatgctacagattaagagcaagaat
agtcaaaatcccaacagtgaagcttttcgactggaggtcccagtcagggccaaagcccat
gtggagctgtttgggaactctttcccagcttccgtggtactctccccaccccctgagggg
accctggggaacgaggacccaataactgtagacaggagtacctacaagatggaagatatt
tccaaggtggaacatgcatttgagctccacaaccagggtccagggaccgtgactgggctt
cggcttcagataggcttccctagccactcccagactgacgacctgctctacgtgctggat
gttcaggcccaagggggcctccagtgctctgctcagcctccccccaatcctctcaatctg
aaagttgggcaaccgacccctgctcccagctctgcccccacccaccctttccagcacgaa
cgagagaagaggaatgtttttatcccagagcatctagagccctctgagctccaagaaccg
atagtcctgaactgcgacacttggccctgcacctgggtggagtgcgagctgaagcagatg
gagcgaggccagcggtccatggtcaccatatccaccattctgtggccgcctggcctcttc
aagaggcccttggaacagtttgtcttgaagtctgaagcctggttcaatgtctctgggctg
ccttacgatgtgcctgttgaaagcctacctcatggaaatgttatggtgcagaccaatcta
cttcgagtactcttggaagaaagggagattcccacctggtgggtggtcgtgggtgtgatg
ggcggtctacttttgctggccctgctcatccttgtaatgtggaaggttggcttcttcaaa
aggaatcgcccacccttagaagaagaagaggaagaggaataa

DBGET integrated database retrieval system