KEGG   Phascolarctos cinereus (koala): 110206829
Entry
110206829         CDS       T05867                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04020  Calcium signaling pathway
pcw04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110206829 (CACNA1E)
   04020 Calcium signaling pathway
    110206829 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110206829 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110206829 (CACNA1E)
Ion channels [BR:pcw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110206829 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 110206829
NCBI-ProteinID: XP_020840016
LinkDB
Position
Unknown
AA seq 2461 aa
MVPEMHGRSPCPAYKSQELIPASATRESPELGVAAHRHILSLPEEETWRQHSPGMMPTQT
SALLEPEALEDTGALPGSPRALCFDASSVFFPMQEGEGSGWEGSGALDASLSPFLPVSPE
VMKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSEQSRN
RQGTPMQSAGPAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKK
LIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIV
ALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGI
PSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGVLEGFDP
PHPCGVQGCPEGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGA
TWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYR
AWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLAR
ASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYWIVLSVVALNTACVAIVHHNQPLWL
THLLYYAEFLFLGLFLLEMALKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGT
SFGISVLRALRLLRIFKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQL
FGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFI
VLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMP
SIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPP
MNPLNPLNPLSPLNPLNAHPSLYRRPKPLEGLGLEKFEEEHGNRGDFHKGEGLQQSEDQK
SPVSRPKREQPWLSKPCHGNCDPAEQESGVGEVVVGFEERTRHRQSQRRSRHRRVRTEIK
EQATSAESRSGSQERGLEDETAEGEKNRDSKGSQEGKEVSIHEEERSKELKRTNSLMVPG
GCGLSTSADEIRTPLVLPHPELETGKDNSLTEQEQEGTSDQALLEDVQLDMGRAISRSEP
DLSSVTANMEKGTESTSIAVTMPDVGTLVDSTVVHISNKTDGEASPLKEAEIKEDGEEVE
KKRKKEKSSSTGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAA
EDPVLTNSERNKVGLRYFDYXFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVV
GALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFN
ILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRH
EFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFP
FFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRV
WHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTIVFSLECILKIIA
FGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGY
TIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFG
SLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYFYFVSFIFFCS
FLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLM
SPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQL
DSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLE
EQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGYPSMSPLSPQEIFQLAC
MDPNHGEFQEQQSLEPEVSDLKIVQPSKHGSYLPSDTQEHAVSGRASSMPRLTMDPQVVT
DPSSMRRSFSTIRDKRTNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNADSGHK
SDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQGDWESPERHQSRSPSEGRSQTSNR
QGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYSSLMRHPGSISPPYDGSEVG
SPLPSKALESNDACLTESSSSPQAKQSQHSTPQRYISEPYLALHEDSHASDCGEEETLTF
EAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDK
C
NT seq 7386 nt   +upstreamnt  +downstreamnt
atggtgccagagatgcatggacgcagcccgtgcccagcctacaagtcccaggagctcatc
cctgcctcggccacacgggaaagccctgagcttggtgttgctgcccaccgacacatcctg
tccttgcctgaggaggagacatggcgccagcacagcccaggcatgatgcccacccagact
tctgctctgctagagcccgaggccctggaagatacaggggccctaccaggatccccacgt
gccctgtgcttcgatgcctcctctgttttcttccccatgcaggagggtgaaggctcagga
tgggaaggcagcggtgccctcgatgccagtttgagcccattcctccccgtgagcccagag
gtcatgaagcggaggcggggagggctcattgagcagagggatatcatcaaggcccatgaa
gctcacaagatgcagagcacacctcaagcccggaggaaagaatgggagatggctcgattt
ggggaggctgtggttggcaggccaggatccggagatggagattcggagcagagcaggaac
cggcaaggaacaccaatgcagtccgcggggccagcggccgcctacaagcaatccaaagcc
cagagggccaggactatggctttatacaaccccattccggtcaggcagaactgtttcacc
gtcaacagatccctgtttatcttcggagaagataacattgtcaggaaatatgccaagaag
ctcatcgattggccgccatttgagtatatgattctggccacaatcattgccaactgcatt
gtcttggcattggagcaacatcttccagaggatgacaagactcctatgtccagaagattg
gagaagacagaaccatatttcattgggattttttgctttgaagctgggattaaaattgta
gccctggggtttatcttccacaagggctcatatctccgaaatggctggaatgtcatggac
ttcattgtggttctcagtggcatcctggccacagctgggacccacttcaatacccatgtg
gacctgaggaccctccgggctgtgcgagtactaaggccactgaaacttgtgtcaggcatt
cccagtttgcaaatagtgctgaagtccatcatgaaggcgatggtgcctctcctacagatt
ggccttcttctgttctttgccatcctaatgttcgccatcattggcctggagttttatagt
ggaaaactacatagggcctgctttatgaacaattcaggtgtgctggaggggtttgaccct
ccccacccatgtggggtgcagggctgcccagagggctatgagtgcaaggactggattggc
cccaatgatgggatcactcagtttgacaacattctctttgctgtgctgactgtcttccag
tgtataaccatggaaggatggaccaccgtgctgtataataccaatgatgccttaggagcc
acctggaattggctgtacttcatccccctcatcatcattggatccttctttgttctcaac
cttgtcctgggagtgctttctggggaatttgccaaagaaagagagagagtggagaaccgc
agagcctttatgaaactgcggagacagcaacaaattgaacgggagttgaatgggtatcga
gcctggatagacaaagcagaggaagtgatgctggctgaagaaaacaaaaattctggaaca
tcagctttggaagtgctccgaagggcaaccatcaaaaggagtcgtactgaggccatgact
cgtgactcaagtgatgaacactgtgttgacatctcctctgtgggcactcctcttgctcgt
gccagtataaaaagtactaaagtagacggagcctcttatttccggcacaaggagcggctt
ctacgtatctccattcgtcatatggtcaaatcccaagttttttactggatagtcttgagt
gtggtagctctcaacactgcctgtgtggctattgtccatcacaaccagcccctgtggctc
acccacctcctctactatgcagagtttttgtttttggggctcttccttttagaaatggcc
ctgaagatgtatggcatggggccacgcctttattttcattcctcctttaattgctttgac
tttggggtcaccgtgggaagtatctttgaagtggtttgggccatctttagacctggcacc
tcttttggaatcagtgtcttgcgggctctccgacttctgagaatatttaaggttaccaag
tattgggcgtctcttcggaatttagtggtctccttaatgagttccatgaaatccatcatc
agcttactcttcctcctcttcctctttattgttgtctttgctctgttgggaatgcagctc
tttggaggcaggtttaactttaatgatgggactccttccgcaaactttgacacctttcct
gcagccattatgacggtattccagatcttgacaggtgaggactggaatgaggtgatgtac
aatgggatccgctcccagggtggagttagctctggtatgtggtctgccatctacttcatc
gtgctcactctgtttggaaactacaccctactgaatgtgtttttggccatcgctgtggac
aatttggccaatgctcaggagctgacaaaggacgagcaggaggaggaggaggccttcaat
cagaagcatgccctacagaaagccaaggaagtcagcccaatgtctgcacctaacatgcct
tctattgaaagagacagaaggaggagacaccacatgtcgatgtgggagccacgcagcagc
cacctgagggagaggaggagacgtcaccatatgtctgtgtgggaacagcgcaccagtcag
ctgaggagacacatgcagatgtccagccaggaaggcatcaacaaggacgagccccctccc
atgaatcccctgaaccctctcaatcccctcagccctctcaatcccctcaatgcgcatcct
agtctctacaggaggcccaagcctttagagggtctgggactggagaagtttgaggaggag
catggaaaccgtggagactttcataagggggaagggctacaacaatcagaagaccagaag
agtcctgtgtctaggcctaagagggagcagccatggctctctaagccatgccatggaaac
tgtgacccagcagagcaggaatcaggagttggagaggtggtggtgggctttgaggagcgg
acccggcaccggcaaagtcagcgccgaagccgacaccgtcgagtccggactgagatcaag
gagcaggccacaagtgctgaaagcaggtccgggagccaggagagaggcctggaagatgaa
acagctgagggggagaagaacagggactctaaggggagtcaggaggggaaggaggtttct
attcatgaagaagagagaagcaaagagttaaagagaacaaacagccttatggttcctgga
ggctgtgggctgtcaacatctgctgatgaaataaggacccccctggtcctccctcatccg
gagttagaaacaggaaaggacaacagcctgacagagcaggagcaggagggtaccagtgac
caagctctgctggaagatgtgcagctggatatgggccgggccatcagtcgcagtgagcct
gacctttcctccgtaacagccaacatggagaagggcacagagagcaccagcatcgccgtt
accatgcctgatgtgggcaccttggtggactccactgtggtgcacattagcaacaagaca
gatggagaagccagccccttaaaggaggcagagattaaagaggatggagaagaagttgag
aagaagcgaaagaaggaaaagagttcaagcacaggcaaagcaatggtgccccatagctcc
atgtttatcttcagcaccactaacccgattcgaagggcgtgccactacattgtgaatcta
cgctactttgagatgtgcatccttttggttattgcagccagcagcatcgccttggctgcc
gaggatcctgtcctgaccaactcagaacggaacaaagtgggtctgaggtattttgactat
ngtttcactggcgtgttcacttttgagatggtcataaagatgatagaccagggcctgatc
ctgcaggatggatcttatttccgagacctgtggaatatcctggactttgtggtggtggtc
ggggcactggtggcctttgctttggcgaatgctttgggcaccaacaaaggccgggatatc
aaaaccattaagtctttgcgtgtgctccgagttctgaggccgctgaaaaccatcaagcgc
ttacccaagctcaaggctgtctttgactgtgtagtgacctccctgaagaatgtattcaac
atactcattgtctacaagctcttcatgttcatctttgccgtcattgcagtccaactcttc
aaggggaaattcttttattgtacagacagctccaaagacacagaaaaggaatgcataggc
aactatgtggatcatgagaaaaacaagatggaggtaaagggtcgggaatggaaacgccat
gagttccactatgacaacatcatctgggccctgttgacccttttcactgtgtccactggg
gagggctggccgcaagttttgcagcattctgtggatgtgactgaggaagaccggggccca
agccgcagcaaccgcatggaaatgtccattttttatgtggtatactttgtggtcttccct
ttcttctttgtcaacatctttgttgccctcatcatcatcactttccaggaacaaggggac
aagatgatggaggagtgtagcctggaaaagaatgagagggcgtgcatcgactttgccatc
agtgccaaaccactcacccgctacatgccccagaatcggcatacatttcagtaccgtgtc
tggcacttcgtggtgtccccatccttcgaatacaccatcatggccatgattgccttgaac
accgtggtgctgatgatgaagtactactctgctccctgtacctatgaactggcattaaag
tatctgaatatagccttcaccatcgtgttctccctggaatgcatcctcaagatcatcgct
tttggcttcttgaattatttccgagacacctggaacatctttgatttcatcacagtcatc
ggcagcatcacagaaattatcctgacggacagcaagctggtgaataccagtggcttcaac
atgagtttcctaaagctcttccgagcagcccgtctcattaagctcttgcgacagggttat
accatccgcattttgctatggacttttgttcagtcttttaaggccctcccctatgtctgt
ctactgattgccatgcttttcttcatttatgccatcattgggatgcaggtctttggaaac
ataaaattagatgaagagagtcacattaaccggcataacaacttccgcagcttttttggg
tccctcatgctgctcttcaggagtgccacaggtgaggcgtggcaggaaattatgttatct
tgtctgggagagaaaggctgcgagcccgataccactgcaccctcagggcagaatgaaaat
gaacgatgtggcactgatctggcctacttttactttgtttctttcatcttcttctgctcc
tttttgatgcttaacctgtttgtggctgtcatcatggacaattttgagtacctgacccgg
gactcatctatcctcgggcctcatcacttggatgaatttgtccgagtctgggcagagtat
gatcgagctgcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatg
tcaccaccgctaggcctcggcaagagatgtccctccaaagtggcgtataagagattggtc
ctgatgaacatgccagtagctgaggacatgactgtccatttcacttccacactaatggcc
ctaattcggacagctctggacatcaagattgcaaaaggtggtgcagacaggcagcagcta
gattcagagctgcaaaaggagaccctggctatctggcctcatctttcccagaagatgctg
gatttgcttgtacccatgccaaaagcctcagacttgacagttgggaaaatatatgcagcc
atgatgatcatggactattacaagcaaagcaaagtaaagaagcagagacagcagctagaa
gaacagaaaaatgctcccatgttccagagaatggagccttcatctttgcctcaggagatc
atttctaatgccaaagccctgccttacctccagcaggacaccctttcaggcctgagcagt
cggagtgggtacccgtctatgagcccactctccccccaggaaatattccagttggcttgc
atggacccaaaccatggggagttccaggagcagcaatctctggagccagaggttagtgat
ttaaaaatcgtgcagccctctaaacatggcagctacctcccttcggacacccaggagcat
gcagtatctgggagggcatcatctatgccacgcctgactatggatccccaggtggtgacg
gacccaagctccatgaggcgttccttttccactatcagagacaagcgtacaaactcctct
tggttagaggagttttcaatggagcgaagcagtgaaaacacctacaagtcccgccgacgc
agttaccattcttccttgcgcctgtcagctcaccgtctgaatgccgactcaggtcacaaa
tctgatacccatcgctcaggaggcagagaacgtggtcgatccaaagaacgtaagcacctt
ctgtctcctgatgtatcccgctgtaactctgaagaacggggtacccaaggtgactgggag
tctcctgagcgacaccagtctaggtcacctagtgagggcaggtctcagacatccaacaga
cagggtacaggttcccttagtgaaagctccattccttctatctctgacaccagcacccca
aggcgaggtcgtcggcagcttccacctgttccccctaaaccccggcccctcctctcctac
agttctttgatgcgacatcctggtagcatctcccctccatatgatgggagtgaagttggt
tccccactgccctccaaggccctggagagcaatgatgcctgcctgactgagtcttccagc
tcaccacaagcaaagcagagtcaacactccactccccagcgctatatctcagagccctac
ctggctttgcatgaagactcccatgcctcggactgtggcgaggaggaaacactcaccttt
gaggctgctgtggctaccagcttgggccgctccaacaccattggctcagcccctcctctg
aggcacagctggcagatgcccaatgggcactaccggaggcggaggcgtgggggaccaggg
ccagggatgatgtgtggggctgttagcgatctcctgagtgacacagaagaggatgataaa
tgctag

DBGET integrated database retrieval system