KEGG   Phascolarctos cinereus (koala): 110206952
Entry
110206952         CDS       T05867                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw05144  Malaria
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05211  Renal cell carcinoma
pcw05218  Melanoma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110206952 (HGF)
   04014 Ras signaling pathway
    110206952 (HGF)
   04015 Rap1 signaling pathway
    110206952 (HGF)
   04020 Calcium signaling pathway
    110206952 (HGF)
   04151 PI3K-Akt signaling pathway
    110206952 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110206952 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206952 (HGF)
   05205 Proteoglycans in cancer
    110206952 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110206952 (HGF)
   05226 Gastric cancer
    110206952 (HGF)
   05218 Melanoma
    110206952 (HGF)
   05211 Renal cell carcinoma
    110206952 (HGF)
   05223 Non-small cell lung cancer
    110206952 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    110206952 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110206952 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110206952 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110206952 (HGF)
Cytokines and growth factors [BR:pcw04052]
 Growth factors
  Growth factors (RTK binding)
   110206952 (HGF)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110206952 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Other DBs
NCBI-GeneID: 110206952
NCBI-ProteinID: XP_020840128
UniProt: A0A6P5K549
LinkDB
Position
Unknown
AA seq 729 aa
MWVTQLLPILVLHQVLQHLLLLPITISFAEGQRKRNTLHEFKKSAKTTLIRLDSSLNIKT
KRLNTTDKCAKRCIRNKGLPFTCKAFAFDKAKKRCHWFPFNSMSNGVRKKHDHEFDLYEN
KDYIRNCIIGKGGSYKGTISITKSGIKCQPWNSMIPHEHGFLPSSYRGKDLQENYCRNPR
GEEGGPWCFTSNPEVRHEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPH
RHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSTMNNSDIPME
TTHCVRGQGEGYRGTVNTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAE
SPWCFTTDPNIRIGYCSQIPKCDVSSQQDCYRGNGKNYMGSLSKTRSGLICSMWDKNMED
LHRHTFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVNLD
HPVISCAKTKQLRVVNGIPTQTNVGWMVSLKYRNRHICGGSLIKESWVLTARQCFPSRTK
DLKDYEAWLGIHDVHGRGEEKHKQVRNISQLVYGPEGSDLVLLKLARPAVLDDFVSTIDL
PNYGCTIPEKTTCSVYGWGYTGLINFDGLLRVAHLFIMGNEKCSQYHQGKITMNESEICA
GTEKIGTGPCEGDYGGPLVCEQHKMRMVIGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKI
ILTYKVPQS
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgtgggtgacccaacttctgccaatactggtgctgcatcaggttcttcaacatctcctt
cttcttcccatcaccatttcctttgcagagggccagaggaaaagaaataccctacatgaa
ttcaaaaagtcagcaaagactaccctaatcagactagactcatcactgaatattaaaact
aagaggctgaacacgacggacaaatgtgccaagcgatgtattaggaataaaggccttcca
ttcacttgcaaggcctttgcttttgacaaagcaaaaaaacgatgtcattggttccctttc
aatagcatgtcaaatggagtgagaaagaagcatgaccatgaatttgatctgtatgaaaac
aaagattacattagaaactgtatcattggtaaagggggaagctacaagggaactatatct
ataactaagagtggtatcaaatgccaaccatggaattcgatgataccacatgaacacggc
tttttgccttcgagctatcgggggaaagacctacaggaaaattactgtcgaaatcctcga
ggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgccatgaagtctgt
gacattcctcagtgttcagaagttgaatgtatgacttgcaatggggaaagttaccgaggt
cccatggatcatactgaatcaggcaagatatgtcagcgctgggatcatcagacaccacac
cgacacaaattcttgccagagagatatcctgacaagggctttgatgataattattgccgc
aatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccttgggaa
tactgtgcaattaaaacatgtgctcatagtacgatgaataatagcgatattcctatggaa
acgacccactgtgtcagaggtcaaggagaaggttatcgaggtactgtgaacacaatatgg
aatggaattccgtgccaacgctgggactcccagtatcctcatcagcatgatataactcct
gagaacttcaaatgcaaagacttaagagaaaattactgtcgaaatccagatggggctgaa
tcaccctggtgttttacaacagatccaaatattagaattggttattgttcccagattcca
aaatgtgatgtttcaagtcaacaagactgttatcgtggaaatggcaaaaattatatggga
agtttatccaaaacaagatctgggctgatttgttccatgtgggacaagaatatggaagac
ttacaccggcatactttctgggaaccagatgctagtaaactgaataagaattactgccgt
aatcctgatgatgatgcccatgggccctggtgttacacaggcaatcctctagttccttgg
gattactgcccaatatctcgctgtgaaggtgatactacacctacaatagtcaatttagac
catcctgtcatttcctgtgcaaaaacaaaacagttacgagtagtaaatggaatcccaaca
caaacaaatgtgggatggatggttagtttgaaatacagaaataggcatatctgtggaggt
tcattaataaaagaaagttgggttttaaccgcaagacaatgtttcccttctcgaactaaa
gatttgaaggactatgaagcttggcttggaattcatgatgttcatggaaggggagaagag
aaacacaaacaagttcgaaatatctctcaattagtatatggacctgaaggatcagacttg
gttttactaaagcttgcaagacctgcagtactggatgactttgttagtacaattgattta
cctaattatggctgcacaattcctgaaaagactacttgtagtgtatatggatggggatac
actggattaatcaactttgatggtctccttcgtgtagcacacttgtttatcatgggaaat
gagaaatgtagtcaatatcatcaagggaagatcacaatgaatgagtctgaaatctgtgct
gggactgaaaaaataggaacaggaccgtgtgagggagattatggtggcccactggtttgt
gaacagcataaaatgagaatggtcattggtgttattgtacctggtcgtggctgtgccatt
ccaaaccgccctgggatttttgttcgagtagcttattatgcaaagtggattcacaaaatc
atattgacatacaaggtacctcagtcatag

DBGET integrated database retrieval system