KEGG   Phascolarctos cinereus (koala): 110213181
Entry
110213181         CDS       T05867                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04640  Hematopoietic cell lineage
pcw04916  Melanogenesis
pcw05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110213181 (KITLG)
   04014 Ras signaling pathway
    110213181 (KITLG)
   04015 Rap1 signaling pathway
    110213181 (KITLG)
   04072 Phospholipase D signaling pathway
    110213181 (KITLG)
   04151 PI3K-Akt signaling pathway
    110213181 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110213181 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    110213181 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110213181 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110213181 (KITLG)
Cytokines and growth factors [BR:pcw04052]
 Growth factors
  Growth factors (RTK binding)
   110213181 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 110213181
NCBI-ProteinID: XP_020849114
LinkDB
Position
Unknown
AA seq 309 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICGNPVTDDVKEITTLVANLPNDYLIPLNYVPG
MELLISQACAFPPMLQIVTLSTLYVATTLPLCCSAANLMEPNHCWLHLMVPELANSLNNL
LYKFSKISSSLSNYSIIDKLIKIIDDLMGCLEEKNKNFRKQNNNIYREGSFIPEQFFSFF
NKSIDAFKEFEETSEQSACILPSTIGPEKDFRVNVTKPFLLPPVAASSLRNDTSSSNRKA
SGSAKDPSVHWVAIVLPSLFSLIIGFVLGVLYWKKKQMSLKMEGENREISEEDNEISMLQ
EKEREFQEV
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcagctgctcctattcaac
cctctcgtcaaaaccaaagggatctgcgggaatcctgtgaccgatgatgtgaaagagatt
acaacattggtggcaaatcttccgaatgactatttgatacctcttaactatgtccccggg
atggaactgttgatctcacaggcatgtgcattccctcctatgttgcagatagtaactctc
tccacactttatgttgctacgacattaccactttgttgttcagcggccaaccttatggag
cctaatcattgttggttacatttgatggtgcctgaattggccaacagcctgaataacctc
ttgtacaaattttccaaaatttccagtagtctcagtaattattcaatcattgataaactc
ataaaaatcattgatgacctgatgggatgcttagaagagaaaaataagaatttccgaaag
caaaataacaacatttaccgagaaggctcgttcattcccgaacagttttttagcttcttt
aataaatccatcgatgccttcaaggaatttgaagaaacatctgagcagagcgcctgcatc
ctgccttcaacaatagggcctgagaaagatttcagggtcaatgtcacaaaaccatttttg
ttaccccccgttgcagccagctcccttaggaatgacaccagtagcagtaataggaaggca
tcaggatctgctaaagacccaagtgtgcactgggtagccattgtattgccatcactgttt
tctctcataattggctttgttctgggagtcttatactggaagaaaaaacaaatgagtctt
aaaatggaaggtgaaaacagagagattagtgaagaggataatgagataagtatgttgcaa
gaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system