KEGG   Phascolarctos cinereus (koala): 110219544
Entry
110219544         CDS       T05867                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5
  KO
K08015  Ras association domain-containing protein 5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04218  Cellular senescence
pcw04670  Leukocyte transendothelial migration
pcw05200  Pathways in cancer
pcw05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110219544 (RASSF5)
   04015 Rap1 signaling pathway
    110219544 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110219544 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110219544 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110219544 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110219544 (RASSF5)
SSDB
Motif
Pfam: RA Nore1-SARAH Sdh5 DUF4699
Other DBs
NCBI-GeneID: 110219544
NCBI-ProteinID: XP_020858602
UniProt: A0A6P5LK46
LinkDB
Position
Unknown
AA seq 266 aa
MTVDSTMSSGYCSLDEDLEDCFFTAKTSFFRNAQSKAPSQNVCKPVEEEKRQVPTLKEIK
QKIDSYNSKEKNCLGMKLSDDGTYTGFIKVHLKLRRPVTVPAGIRPRSIYDAVKEVNLAA
TTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRTHKDGQVLF
QKLSITECPLYLRLLAGPDTDILSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKI
QQVQKKYDKFKQRLEELLRDAQGKPG
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaccgtggacagcaccatgagcagtgggtactgcagcctggatgaagatctggaggac
tgtttctttactgccaagacttcctttttcaggaatgcacagagcaaggccccctcccag
aatgtctgcaaacccgtggaagaggagaagcgccaggtccccacacttaaggaaatcaaa
cagaaaattgacagttacaatagcaaggagaaaaattgtctgggcatgaagctgagcgat
gatggtacctacacaggcttcattaaagtgcatctgaagcttcggaggccggtgacagta
ccggctgggatccggccccggagtatctacgatgccgtcaaagaggtgaacctggctgcc
accacggacaagaggacgtccttctacttgccgctggacgccatcaagcagctgcatatt
agcagtaccaccacggtcagcgaagtcatccaggggctcctcaagaagttcatggtagtg
gacaatccccagaagtttgctctgttcaagcggacgcacaaggatggacaagtgctattt
cagaaactctccatcaccgagtgtcccctttaccttcgcctgctggccggccctgacaca
gacatcctcagttttgtgctgaaggagaacgagacaggagaggtggagtgggatgctttc
tccatcccagagctccagaacttcttaaccattctggaaaaggaagaacaggacaaaatc
cagcaagtgcagaagaagtatgacaagttcaagcaaagactggaggaactcttgagagat
gcccagggcaaacctggctaa

DBGET integrated database retrieval system