KEGG   Phascolarctos cinereus (koala): 110220802
Entry
110220802         CDS       T05867                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110220802 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110220802 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcw03310]
    110220802 (NR3C1)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110220802 (NR3C1)
Nuclear receptors [BR:pcw03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   110220802 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 110220802
NCBI-ProteinID: XP_020860652
LinkDB
Position
Unknown
AA seq 772 aa
MDSKESLSTSLGEETTKSIHGRSRGNVMDYYKTIRGGATVKIPASSSSVAAASQSDSKQQ
PLLGDYSKVSASSAQQPDLSKAVSLSMGLYMGDTDSKVMGNDLVFPQQGQIGVSSGETDF
RLLEESIASLSKSSRVSKSPKSSASSATDNEFPTTSNFDKTLEKPTLKKGPTGTNDGSTK
LYTEDQSTFDILQDLELPSGSPSKEANESPWRLDPLLDENCLLSPLATDESFLLEGNADE
DCKPLILPDTKPKITEQGGLILPSSNMPLPQVKTEKEDFIELCTPGVIKQEKLGPVYCQG
SFSGANIIGNKMSAISVHGVSTSGGQMYHYDLNTSSVSQQQDHKPVFNVIPPIPVGSENW
NRCQGSGDDNLTSLGTLNFTNRSVFSNGYSSPGMRPDVSSSPSSSSTTAGPPPKLCLVCS
DEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQA
GMNLEARKTKKKIKGIQQPNPATRENSESPVNKTVVPASLPQLTPTLVSLLEVIEPEVLY
SGYDSSLPDSTWRIMSTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMS
FALGWRSYKQSSGNLLCFAPDLIMNEQRMNLPCMYDQCKHMLLVSSELQRLQVSYEEYLC
MKTLLLLSTVPKEGLKSQSLFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSM
HEIVESLLNYCFQTFLDKTMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggactcaaaagaatcgttaagtacctctcttggagaagaaaccaccaaaagtatacat
ggtcgaagcagaggaaatgtaatggactattataaaaccataaggggtggagctactgtg
aagattcctgcgtcttcatcctcagtggctgctgcttctcagtcagactctaagcagcag
cctcttttgggtgactattctaaagtatcagcaagcagtgcacagcagccagacctgtcc
aaggcggtctcactatcaatgggactctacatgggtgatacagattcaaaagtgatggga
aatgatctagtatttcctcagcagggccaaattggtgtttcttctggtgaaacagatttt
aggcttcttgaagaaagcatcgccagcctcagtaagtcatccagggtgtccaaaagcccc
aagagttcagcatcttctgctacagacaatgaatttccaacaacatctaatttcgataaa
actttagaaaagccaactttaaaaaagggcccgactggcactaatgacggcagtacaaaa
ctgtatactgaagaccaaagcacctttgatattttacaggatttggaattgccctctggg
tccccaagtaaggaggcaaatgagagcccttggagattagaccccttgctagatgaaaac
tgtttgctttctcctttggcaacagatgagtcatttcttttagaaggaaatgcagatgaa
gactgcaagcctcttattttgccggacactaagcctaaaattactgagcaggggggtctg
attttgcccagttctaatatgccattgcctcaagtgaaaacagaaaaggaagattttatt
gaactttgtactcctggggtaattaaacaggagaaactgggcccagtttactgtcaagga
agtttttctggggcaaatataattggtaacaagatgtctgccatttctgttcatggtgtg
agtacctctgggggacagatgtaccactacgacttgaatacttcgtctgtttctcagcag
caggatcacaagcctgtatttaatgtcattccacccattcctgttggttcagaaaattgg
aataggtgccagggatctggagatgacaacttgacttccttgggaactctaaatttcact
aatagatccgttttttctaatggatattcaagccctggaatgagaccagatgtgagctct
tctccatccagttcctccacaacagcgggaccaccccccaaactctgccttgtttgctct
gatgaggcttcaggatgtcattacggtgtcctaacgtgtggaagctgtaaagtgttcttc
aaaagagcagtggaaggtaggcagcacaattatctttgtgctggaagaaatgattgtatc
attgataaaattcgaagaaaaaactgcccagcatgtcgttaccgaaaatgtctccaagct
ggaatgaacctagaagctcgaaagacaaagaagaaaattaaaggaattcagcaacccaat
ccagcaacaagagagaattctgaaagtcctgtcaacaaaacagtggttcctgcgtcattg
ccacagctcaccccaacgctagtgtcactcctggaggtcattgagccagaggtgttatat
tcaggatatgacagttcgttgcctgatagcacttggaggatcatgtcaacacttaacatg
ttaggaggacggcaagtgattgcagcagtgaaatgggcaaaggcaataccaggtttcaga
aacttacacctggatgaccaaatgaccctgctgcaatactcctggatgttcctgatgtct
tttgcactagggtggagatcatacaaacaatcaagcggcaacctgctgtgtttcgctcct
gacctgattatgaatgagcagaggatgaatttaccctgcatgtatgaccaatgtaaacat
atgttacttgtgtccagtgaattacaaaggcttcaggtgtcttatgaagaatatctctgc
atgaaaaccttattacttctctctacagttcccaaggaaggtttgaagagccagtcactc
tttgatgagattagaatgacttacatcaaagagctggggaaagccatagtcaagagggaa
ggaaactcaagtcagaactggcagcgattttatcagctcactaaacttctggactccatg
catgagatagttgaaagccttctgaactattgcttccagacatttttggataagaccatg
agcatcgagttcccagagatgttggctgaaattatcagcaatcagataccaaaatactca
aatggaaatatcaaaaaattgctctttcatcagaaatga

DBGET integrated database retrieval system