KEGG   Phascolarctos cinereus (koala): 110222927
Entry
110222927         CDS       T05867                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04062  Chemokine signaling pathway
pcw04068  FoxO signaling pathway
pcw04137  Mitophagy - animal
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04722  Neurotrophin signaling pathway
pcw04917  Prolactin signaling pathway
pcw05213  Endometrial cancer
pcw05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110222927 (FOXO3)
   04151 PI3K-Akt signaling pathway
    110222927 (FOXO3)
   04152 AMPK signaling pathway
    110222927 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110222927 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    110222927 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110222927 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110222927 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110222927 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    110222927 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    110222927 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    110222927 (FOXO3)
   05223 Non-small cell lung cancer
    110222927 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110222927 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110222927 (FOXO3)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    110222927 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 110222927
NCBI-ProteinID: XP_020863865
UniProt: A0A6P5LZE1
LinkDB
Position
Unknown
AA seq 689 aa
MAEAPSSPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGEAAADSMIPEE
EDDEEDDDGGCGAPGGGGGAGTAMAMAGTSGVLGPGLRPEEAARLLAPGGQDSGSGAPSG
AGVLSGGQQAPLQPQQAPLPLPPPPPPPLQPQQQGASGAAGQPRKCSSRRNAWGNLSYAD
LITRAIESSPDKRLTLSQIYDWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFKRVQ
NEGTGKSSWWMINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKASLQASQETTEDS
PSQLTKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPILATTELDDVQDDDPPLS
PMLYSNSSSVSPSVSKPCTVELPRLTDMAGTMNLNDGLTDNLMDDLLDNIALPPSQQSPS
SGLMQRSSSFPFTTKGSGLGSPSGSLNNAVFGPSSLNSLRQSPMQTIQENKPATFSSMSH
YSNQSLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQSN
QGSLVSQNLLHQQHQTQSPLGGNRALSNAVNSMGLSDTNNLGSAKHQQQSPASHSMQTLS
DSLSGSSLYSTSVNLPVMGHEKFPSDLDLDIFNGSLECDMESIIRSELMDADGLDFNFDS
LISAQNVVSLNVGNFTGAKQASSQSWVPG
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggcagaggcgccgtcctccccggcccctctctcgccgctggaagtggagctggacccg
gagttcgagccccagagccggccccgctcctgtacgtggcccctgcagaggcccgagctg
caggcgagcccggccaagccctcgggggaagcggccgccgactccatgatcccagaggag
gaggacgacgaggaagacgacgacggaggctgcggagcccctgggggcggtggaggagcc
ggcacggccatggccatggccggcacgagcggcgtcctcggcccaggactgcgccccgag
gaggcggcccgcctcctggcccctggagggcaggactcggggtccggcgcgccctccggg
gcaggcgtgctgagcggggggcagcaggcgccactgcagccgcagcaggcgccgctgccg
ctgccccctccgccgccgccgccgctgcagccgcagcaacagggggcgagcggggccgcg
gggcagccgaggaaatgctcctcccggaggaacgcgtggggaaacctgtcctacgccgac
ctgatcacccgggccatcgagagctccccagacaagcggctcaccctgtcccagatctac
gactggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaacagctccgct
ggctggaagaactccatccgtcacaacttatccctacacagtcgattcaaaagggtacaa
aatgaagggaccgggaaaagttcctggtggatgatcaatccagacgggggcaaaagcgga
aaggcccctcggcgaagagccgtctccatggacaatagcaacaagtacaccaagagtagg
gggcgggcagctaagaaaaaggcttctctgcaggcttcccaggaaaccacagaagatagc
ccttcccagctcaccaagtggccgggcagccccacctctcgaagcagcgatgagctggac
gcgtggacagacttccgctcccgaaccaactccaacgccagcacagtaagcggacgcttg
tcacccatcctggcgaccactgagctggatgatgtccaggatgacgacccgccgctttcc
ccaatgctgtatagcaactcatcaagcgtgtccccgtcggtcagcaaaccgtgtaccgtg
gaacttccacggctgaccgacatggcaggcacaatgaacttaaacgatggactaacggac
aacctcatggatgacctcttggacaatatcgcgctcccgccctcccagcagtcaccatcg
tcaggactcatgcagaggagctctagcttcccatttaccaccaagggctcaggtctgggg
tctccgtcaggcagcttgaataatgctgtgttcggcccctcttctctgaactctctacgc
cagtctcccatgcagaccatccaagagaataagccggccaccttctcttccatgtcgcac
tacagcaaccagtccctccaggacctgctgacatccgactcgctgagccatagcgatgtc
atgatgactcagtcagatccattgatgtcccaggccagcacagctgtgtctgcccagaat
tcacgaaggaatgtcatgctccgcaatgacccgatgatgtcctttgctgctcagtccaac
cagggaagtttggtcagtcagaatctactccaccagcagcaccaaacccagagtcctctt
ggtggtaaccgtgccttgtctaatgccgtcaatagcatgggcttgagtgacaccaacaac
ctagggtcagccaaacaccagcaacagtcacccgccagccattctatgcaaaccctttct
gactcactctcagggtcctctttgtattctactagtgtgaaccttccagtcatgggccat
gaaaaattcccaagtgatttggacctggatatttttaatgggagcttggaatgtgacatg
gaatccatcattcgcagtgaactcatggatgctgatgggttggattttaactttgattcc
ctcatctctgctcaaaacgttgtcagtctgaatgtggggaacttcactggtgctaagcag
gcctcatctcagagttgggtgccaggctga

DBGET integrated database retrieval system