KEGG   Phascolarctos cinereus (koala): 110223001
Entry
110223001         CDS       T05867                                 

Definition
(RefSeq) interleukin-2-like
  KO
K05429  interleukin 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04060  Cytokine-cytokine receptor interaction
pcw04061  Viral protein interaction with cytokine and cytokine receptor
pcw04151  PI3K-Akt signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04672  Intestinal immune network for IgA production
pcw04940  Type I diabetes mellitus
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05162  Measles
pcw05166  Human T-cell leukemia virus 1 infection
pcw05200  Pathways in cancer
pcw05320  Autoimmune thyroid disease
pcw05321  Inflammatory bowel disease
pcw05330  Allograft rejection
pcw05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110223001
   04151 PI3K-Akt signaling pathway
    110223001
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110223001
   04061 Viral protein interaction with cytokine and cytokine receptor
    110223001
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110223001
   04660 T cell receptor signaling pathway
    110223001
   04658 Th1 and Th2 cell differentiation
    110223001
   04659 Th17 cell differentiation
    110223001
   04672 Intestinal immune network for IgA production
    110223001
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110223001
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110223001
   05321 Inflammatory bowel disease
    110223001
   05330 Allograft rejection
    110223001
   05332 Graft-versus-host disease
    110223001
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110223001
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110223001
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110223001
   05162 Measles
    110223001
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110223001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110223001
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110223001
Cytokines and growth factors [BR:pcw04052]
 Cytokines
  Interleukins
   110223001
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Haparin
  Cytokines
   110223001
SSDB
Motif
Pfam: IL2 IL15 Baculo_PEP_C Sigma70_ner Retrotran_gag_2 FH2
Other DBs
NCBI-GeneID: 110223001
NCBI-ProteinID: XP_020863994
LinkDB
Position
Unknown
AA seq 104 aa
MEVQQKLKTVSERMKKYELYIPSNTSSMSDLQCFTKELNPVVGALKYESKDAQTIQEHIN
NINETVNSLTGTETTQCHYATKMKIEGFFKEFVSFSRKLRALTQ
NT seq 315 nt   +upstreamnt  +downstreamnt
atggaggtccaacaaaaactcaagactgtatcagaaaggatgaagaaatatgaactctac
atcccaagtaataccagtagcatgtcagatctgcagtgtttcactaaagaactgaaccct
gtggttggcgcattgaaatatgaatcaaaagatgctcagactattcaggaacatatcaac
aacattaatgagacagttaacagcttaacgggaacagaaacaacccagtgtcattatgcc
accaaaatgaagatcgaaggattttttaaagaatttgtttccttctcccgaaaactcaga
gcactaactcaatga

DBGET integrated database retrieval system