KEGG   Paenibacillus crassostreae: LPB68_04195Help
Entry
LPB68_04195       CDS       T05196                                 

Definition
(GenBank) formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
pcx  Paenibacillus crassostreae
Pathway
pcx00620  Pyruvate metabolism
pcx00640  Propanoate metabolism
pcx00650  Butanoate metabolism
pcx01100  Metabolic pathways
pcx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB68_04195
   00640 Propanoate metabolism
    LPB68_04195
   00650 Butanoate metabolism
    LPB68_04195
Enzymes [BR:pcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     LPB68_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFL-like Gly_radical DUF3029
Motif
Other DBs
NCBI-ProteinID: AOZ91488
UniProt: A0A162KUY8
LinkDB All DBs
Position
complement(859500..861761)
Genome map
AA seq 753 aa AA seqDB search
MSVIEKEVLKVQNAWRGFKAGKWMKEVNTSNFLDTNIKPYEGNESFLEGATANTKALWEI
VSNLSKQEREAGGVLDVDVNTPSTITSHAPGFLDKDKEQIIGVQGSAPFQRTIRPNGGVR
MVITACKAYGFDLPPEIVDLYTNVRKTHNQGVFDAYTADMRNARHTGIITGLPDAYGRGR
IIGDYRRVALYGVDFLITQKQHELKDLEVAVMDEDVIRLREELSEQIRSLGELKQLGEMY
GFDISRPANTAKEAFQWLYFGYLAAVKEQDGAAMSLGRVSSFLDAYIERDLAEGTMTEET
AQELVDHFVMKLRIVKFLRTPEYNELYSGDPTWVTESIGGMSVNGVTRVTKSSFRFLHTL
NNLGAAPEPNLTVLWSERLPESFKKYCTKVSIETSAIQYENDDLMRPIYGDDYGIACCVS
AMRIGKQMQFFGARANLAKCLLYAINGGKDERYGTQVGPEYPAITSEYLDYDEVMKRFIP
MMEWLANLYVNTLNVIHYMHDKYAYERIEMALHDRDILRTMACGIAGLSVVADSLSAIKY
AKVKPVRNENGIAVDFVTEGEYPCYGNNDDRVDQIAVKLVESFMSMIRKNKTYRNSLPTQ
SILTITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRDKKGALASLSSVAKLPYEDSLD
GISNTFSIVPKALGKEEEIRKSNLVAMLDGYFGSGAHHLNVNVFNRDQLMDAMEHPEEYP
QLTIRVSGYAVNFIKLTREQQMDVINRTFHGSM
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgatcgaaaaagaagtgctaaaagtgcaaaatgcgtggagaggtttcaaagca
ggaaaatggatgaaagaagtcaacacaagtaatttcctagatactaacattaagccttat
gagggtaacgagtctttcttggagggagcgactgcaaacacaaaagcattgtgggagatc
gtgtcgaacttgtccaagcaagaaagagaagctggcggtgtattagatgttgatgtcaac
acaccatctaccataacttctcatgcgccaggctttttagataaagacaaagaacaaatt
attggtgtacaaggttccgcaccattccaacgcacgattcgtcctaatggcggtgttaga
atggtcatcacagcatgtaaagcttacggatttgacttgccacctgaaattgtagacttg
tatacaaatgttcgtaaaacacataatcaaggtgtttttgatgcttatactgcagatatg
agaaatgctcgtcacactggaataattacaggattgcctgatgcttacggccgtggacgg
attattggtgactatcgtcgtgtagcactttacggtgtagatttcctgatcacacaaaaa
caacatgagttgaaagatcttgaagttgctgttatggatgaagatgtaattcgccttcgc
gaagaattgtccgagcaaattcgttctttaggcgaattgaaacaactaggtgaaatgtat
ggatttgatatttccagacctgcaaatactgcaaaagaagcattccaatggttatacttc
ggatacttagcagctgtaaaagaacaagacggagcagctatgtccctcggccgtgtatcc
tctttccttgacgcatacatcgagcgtgatcttgccgaaggaacaatgactgaagaaact
gctcaagaactggttgaccatttcgttatgaagctcagaattgtaaaattccttagaact
cctgaatataacgaactatacagtggcgatccaacttgggtaactgaatccataggtggt
atgtctgtaaacggggtaactcgtgttacgaagagtagcttccgtttcttgcacacactg
aacaatttgggagctgctccagaaccgaacttaacagtgctttggtcagaaagattgcct
gaatccttcaaaaaatattgtactaaagtttccattgaaacaagtgcaattcaatacgag
aacgacgacttgatgcgtccaatctatggcgatgactacggtattgcttgctgcgtatcg
gctatgcgaattggtaaacaaatgcaattttttggggctcgtgcgaacttagctaaatgc
cttctctatgcaattaacggtggtaaggatgaaagatatggtacgcaagttggtccagaa
tatccagcaattacttccgaatacttggattacgatgaagtgatgaaacgtttcatacca
atgatggaatggctggctaatctgtacgtaaatacgcttaacgtaatccactatatgcat
gataaatatgcttacgaacgtattgaaatggcgttacatgatcgtgatattcttcgtaca
atggcttgtggtattgctggtttatccgttgttgccgactcattgagtgccatcaaatat
gctaaagttaaaccggttcgtaacgaaaatggaattgcagtagactttgtaactgaaggc
gaatatccttgctacggtaacaacgacgaccgtgttgaccaaattgccgttaaattggtt
gaatccttcatgagtatgattcgtaagaataaaacttatcgtaactctttgccgacacag
tcaatcttgacgattacttcaaatgtagtgtacggtaagaaaaccggaaatacaccagat
ggacgtaaagcaggtgaaccgttcgcaccaggtgctaacccaatgcatggacgtgataag
aagggtgcactcgcttcactaagctctgttgctaaacttccttatgaagatagcttggat
ggaatctctaatacattctctatcgttcctaaggcattaggtaaagaagaagaaattcgt
aaatctaaccttgtagcgatgctggatggatatttcggtagtggcgctcatcatcttaat
gtcaacgtatttaatcgtgatcaattgatggatgcgatggaacatcctgaagaatatcct
caattgacgatccgtgtctctggatatgcggttaacttcattaaattgactcgtgaacaa
caaatggatgttattaatcgtacattccatggttcaatgtaa

DBGET integrated database retrieval system