KEGG   Paenibacillus crassostreae: LPB68_10995Help
Entry
LPB68_10995       CDS       T05196                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcx  Paenibacillus crassostreae
Brite
KEGG Orthology (KO) [BR:pcx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LPB68_10995
Enzymes [BR:pcx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LPB68_10995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_3 Thi4 NAD_binding_7 AlaDh_PNT_C K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOZ92693
UniProt: A0A167GD93
LinkDB All DBs
Position
complement(2369912..2371438)
Genome map
AA seq 508 aa AA seqDB search
MKLDADIKAQLAQYLELMEGDILLKVSVGTDSVSNDMMDLINELSSMSNKITIEKTQLTR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKVDQSVIDQIKNIKGEYHF
ETYVSLTCHNCPDVVQALNLMSILNPGITHTMIDGAAFKDEVESKEIMAVPTVHLHGEFF
ESGRMTIDDILAKLGTSDASAFENKEAYDVLVVGGGPAGASAAIYAARKGIRTGIVAERF
GGQVNDTLGIENLIGVKYTEGPKLAASLEEHAKEYNIDIMKAQRVKSLEKKDLIEVELDN
GAVLKSKTVIVTTGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVVGGGNSGIE
AAIDLAGIAGHVTVLEFMPELKADSVLQDRLNSMPNTTVLKNAQVKEITGTSKVDGISYI
ERESGETKHIELQGVFVQIGLVPNTDWLGDTVERTRTGEIVVNNHGATNVPGVFAAGDCT
NSPYKQIIISMGSGATAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggatgcagatataaaggcacaactggcgcaatatcttgagcttatggaaggc
gatattctgctgaaagtaagtgtaggtactgattccgtatcgaatgacatgatggatctg
attaatgaactatccagcatgtcaaacaagattacaatagagaaaacacaattaactaga
actcctagttttagcgtaaatcgcgtaggtgaagatactggcgtaacgttcgctgggata
ccgttgggacacgagtttacttcattagtcttggctttacttcaagtgagtggacgagct
ccaaaggttgatcaaagcgttattgatcagattaagaacattaaaggtgagtatcacttt
gaaacatatgtgagcctaacctgtcataactgtcctgatgttgtgcaggcacttaacttg
atgagtatccttaatcctggtattactcatacgatgattgacggagcagctttcaaggat
gaggtagaaagcaaggaaattatggctgtgccgaccgttcatcttcacggtgaattcttt
gaaagtggccgaatgacaattgatgatattcttgctaaattgggcacctcagatgcatcc
gcgtttgagaataaggaagcatacgatgtactagttgtcggaggtggacctgctggagca
agtgcagcaatctatgcggcacgcaaaggtattcgtacggggattgttgctgaacgattc
ggcggacaagtcaatgataccttgggtattgagaacttaataggtgtgaaatacactgaa
ggtccgaagcttgctgcaagtcttgaagaacatgccaaagaatacaacattgatattatg
aaggcacaacgtgtgaagtctttagagaagaaagatctcattgaagttgaattggacaac
ggtgctgttctaaagagtaagactgtaatcgttactacaggtgcccgttggcgtaacctt
ggcgtgcctggtgaagcagaatttaagaataaaggtgttgcttactgtccgcattgtgat
ggtcctttattcgcaggaaaacatgttgcggttgttggtggcggtaactctgggattgaa
gcagcaatcgacctcgcgggtattgcgggacatgtaacggttctggaatttatgcctgag
ttgaaagctgattctgtattacaagaccgtctaaacagtatgccaaatacaactgtactt
aagaatgctcaagtaaaagaaatcactggaacaagcaaagttgacggcattagttacatc
gagcgtgagagcggtgagacgaagcatattgaattgcaaggggtatttgttcaaatcggt
ctcgttcctaatacagactggttaggtgacacggttgaacgtactcgtactggtgaaatt
gttgtgaacaatcatggcgcaaccaatgtccctggcgtattcgctgctggtgactgtaca
aatagcccttataaacaaattattatttcaatgggatcaggtgctactgcagcgttaggt
gcatttgattatcttatccgtaattaa

DBGET integrated database retrieval system